Recombinant Human Septin-7 | MyBioSource MBS1326642 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Septin-7

catalog :

MBS1326642

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1326642

products type :

Recombinant Protein

products full name :

Recombinant Human Septin-7

products short name :

Septin-7

products name syn :

CDC10 protein homolog

other names :

septin-7 isoform 1; Septin-7; septin-7; septin 7; CDC10 protein homolog

products gene name :

7-Sep

other gene names :

SEPT7; SEPT7; CDC3; CDC10; SEPT7A; NBLA02942; CDC10

uniprot entry name :

SEPT7_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

2-437

sequence length :

437

sequence :

SVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQV
YRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPE
YPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFG
DAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNR
VQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKA
DTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENK
LVKKIKDRLPLAVVGSNTIIE

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cell Biology

products description :

Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Required for normal progress through mitosis. Involved in cytokinesis. Required for normal association of CENPE with the kinetochore. Plays a role in ciliogenesis and collective cell movents.

products references :

Molecular cloning of a novel human cDNA homologous to CDC10 in Saccharomyces cerevisiae.Nakatsuru S., Sudo K., Nakamura Y.Biochem. Biophys. Res. Commun. 202:82-87(1994) Biochemical and cell biological analyses of a mammalian septin complex, Sept7/9b/11.Nagata K., Asano T., Nozawa Y., Inagaki M.J. Biol. Chem. 279:55895-55904(2004) Expression profiling the human septin gene family.Hall P.A., Jung K., Hillan K.J., Russell S.E.H.J. Pathol. 206:269-278(2005) Mammalian septins regulate microtubule stability through interaction with the microtubule-binding protein MAP4.Kremer B.E., Haystead T., Macara I.G.Mol. Biol. Cell 16:4648-4659(2005) Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J.Nat. Biotechnol. 23:94-101(2005) Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.Cell 127:635-648(2006) Structural analysis of septin 2, 6, and 7 complexes.Low C., Macara I.G.J. Biol. Chem. 281:30697-30706(2006) Septins regulate actin organization and cell-cycle arrest through nuclear accumulation of NCK mediated by SOCS7.Kremer B.E., Adang L.A., Macara I.G.Cell 130:837-850(2007) Septin 7 interacts with centromere-associated protein E and is required for its kinetochore localization.Zhu M., Wang F., Yan F., Yao P.Y., Du J., Gao X., Wang X., Wu Q., Ward T., Li J., Kioko S., Hu R., Xie W., Ding X., Yao X.J. Biol. Chem. 283:18916-18925(2008) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.Anal. Chem. 81:4493-4501(2009) Septins regulate bacterial entry into host cells.Mostowy S., Nam Tham T., Danckaert A., Guadagnini S., Boisson-Dupuis S., Pizarro-Cerda J., Cossart P.PLoS ONE 4:E4196-E4196(2009) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Structural insight into filament formation by mammalian septins.Sirajuddin M., Farkasovsky M., Hauer F., Kuehlmann D., Macara I.G., Weyand M., Stark H., Wittinghofer A.Nature 449:311-315(2007)

ncbi gi num :

148352331

ncbi acc num :

NP_001779.3

ncbi gb acc num :

NM_001788.5

uniprot acc num :

Q16181

ncbi mol weight :

66.52kD

ncbi pathways :

MAPK Family Signaling Cascades Pathway (1269501); MAPK6/MAPK4 Signaling Pathway (1269506); Signal Transduction Pathway (1269379)

ncbi summary :

This gene encodes a protein that is highly similar to the CDC10 protein of Saccharomyces cerevisiae. The protein also shares similarity with Diff 6 of Drosophila and with H5 of mouse. Each of these similar proteins, including the yeast CDC10, contains a GTP-binding motif. The yeast CDC10 protein is a structural component of the 10 nm filament which lies inside the cytoplasmic membrane and is essential for cytokinesis. This human protein functions in gliomagenesis and in the suppression of glioma cell growth, and it is required for the association of centromere-associated protein E with the kinetochore. Alternative splicing results in multiple transcript variants. Several related pseudogenes have been identified on chromosomes 5, 7, 9, 10, 11, 14, 17 and 19. [provided by RefSeq, Jul 2011]

uniprot summary :

SEPT7: Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Required for normal progress through mitosis. Involved in cytokinesis. Required for normal association of CENPE with the kinetochore. Plays a role in ciliogenesis and collective cell movements. Belongs to the septin family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Cell cycle regulation; Cytoskeletal; Hydrolase. Chromosomal Location of Human Ortholog: 7p14.2. Cellular Component: actin cytoskeleton; apical plasma membrane; axoneme; cleavage furrow; cytoplasm; cytosol; microtubule cytoskeleton; midbody; nucleolus; nucleus; plasma membrane; spindle; stress fiber. Molecular Function: GTP binding; identical protein binding; protein binding; structural molecule activity. Biological Process: cytokinesis; mitosis; protein heterooligomerization; shape changes of embryonic cells

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage