Recombinant Rat Cytochrome P450 1B1 | MyBioSource MBS1325163 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Rat Cytochrome P450 1B1

catalog :

MBS1325163

quantity :

0.01 mg (E-Coli)

price :

110 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1325163

products type :

Recombinant Protein

products full name :

Recombinant Rat Cytochrome P450 1B1

products short name :

Cytochrome P450 1B1

products name syn :

CYPIB1; Cytochrome P450RAP

other names :

cytochrome P450 1B1; Cytochrome P450 1B1; cytochrome P450 1B1; cytochrome P450, family 1, subfamily b, polypeptide 1; CYPIB1; Cytochrome P450RAP

products gene name :

Cyp1b1

other gene names :

Cyp1b1; Cyp1b1

uniprot entry name :

CP1B1_RAT

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-543

sequence length :

543

sequence :

MATSLSADSPQQLSSLSTQQTILLLLVSVLAIVHLGQWL
LRQWRRKPWSSPPGPFPWPLIGNAASVGRASHLYFARLA
RRYGDVFQIRLGSCPVVVLNGESAIHQALVQQGGVFADR
PPFASFRVVSGGRSLAFGHYSERWKERRRAAYGTMRAFS
TRHPRSRGLLEGHALGEARELVAVLVRRCAGGACLDPTQ
PIIVAVANVMSAVCFGCRYNHDDAEFLELLSHNEEFGRT
VGAGSLVDVMPWLQLFPNPVRTIFREFEQINRNFSNFVL
DKFLRHRESLVPGAAPRDMMDAFILSAEKKATGDPGDSP
SGLDLEDVPATITDIFGASQDTLSTALLWLLILFTRYPD
VQARVQAELDQVVGRDRLPCMSDQPNLPYVMAFLYESMR
FTSFLPVTLPHATTANTFVLGYYIPKNTVVFVNQWSVNH
DPAKWSNPEDFDPARFLDKDGFINKALASSVMIFSVGKR
RCIGEELSKTLLFLFISILAHQCNFKANQNEPSNMSFSY
GLSIKPKSFKIHVSLRESMKLLDSAVEKLQAEEACQ

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

other info2 :

Species: Rat

products categories :

Metabolism

products description :

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, retinoid and xenobiotics. Preferentially oxidizes 17beta-estradiol to the carcinogenic 4-hydroxy derivative, and a variety of procarcinogenic compounds to their activated forms, including polycyclic aromatic hydrocarbons. Promotes angiogenesis by removing cellular oxygenation products, thereby decreasing oxidative stress, release of antiangiogenic factor THBS2, then allowing endothelial cells migration, cell adhesion and capillary morphogenesis. These changes are concommitant with the endothelial nitric oxide synthase activity and nitric oxide synthesis. Plays an important role in the regulation of perivascular cell proliferation, migration, and survival through modulation of the intracellular oxidative state and NF-kappa-B expression and/or activity, during angiogenesis. Contributes to oxidative homeostasis and ultrastructural organization and function of trabecular meshwork tissue through modulation of POSTN expression.

products references :

Specificity determinants of CYP1B1 estradiol hydroxylation." Nishida C.R., Everett S., Ortiz de Montellano P.R. Mol. Pharmacol. 84:451-458(2013)

ncbi gi num :

6978737

ncbi acc num :

NP_037072.1

ncbi gb acc num :

NM_012940.2

uniprot acc num :

Q64678

ncbi mol weight :

64.62kD

ncbi pathways :

Arachidonic Acid Metabolism Pathway (1333390); Biological Oxidations Pathway (1333500); Chemical Carcinogenesis Pathway (673233); Chemical Carcinogenesis Pathway (673237); Cytochrome P450 - Arranged By Substrate Type Pathway (1333502); Endogenous Sterols Pathway (1333503); Estrogen Metabolism Pathway (219760); Metabolism Pathway (1333271); Metabolism Of Lipids And Lipoproteins Pathway (1333310); Metabolism Of Xenobiotics By Cytochrome P450 Pathway (83423)

ncbi summary :

plays a role in polycyclic aromatic hydrocarbon metabolism in adrenal microsomes [RGD, Feb 2006]

uniprot summary :

CYP1B1: Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Defects in CYP1B1 are the cause of primary congenital glaucoma type 3A (GLC3A). GLC3A is an autosomal recessive form of primary congenital glaucoma (PCG). PCG is characterized by marked increase of intraocular pressure at birth or early childhood, large ocular globes (buphthalmos) and corneal edema. It results from developmental defects of the trabecular meshwork and anterior chamber angle of the eye that prevent adequate drainage of aqueous humor. Defects in CYP1B1 are a cause of primary open angle glaucoma (POAG). POAG is a complex and genetically heterogeneous ocular disorder characterized by a specific pattern of optic nerve and visual field defects. The angle of the anterior chamber of the eye is open, and usually the intraocular pressure is increased. The disease is asymptomatic until the late stages, by which time significant and irreversible optic nerve damage has already taken place. In some cases, POAG shows digenic inheritance involving mutations in CYP1B1 and MYOC genes. Defects in CYP1B1 are a cause of Peters anomaly (PAN). Peters anomaly is a congenital defect of the anterior chamber of the eye. Belongs to the cytochrome P450 family. Protein type: Motility/polarity/chemotaxis; Oxidoreductase; Membrane protein, peripheral; Endoplasmic reticulum; Amino Acid Metabolism - tryptophan; EC 1.14.14.1; Xenobiotic Metabolism - metabolism by cytochrome P450. Cellular Component: endoplasmic reticulum membrane; integral to membrane; intracellular membrane-bound organelle; mitochondrion; nucleus. Molecular Function: heme binding; iron ion binding; monooxygenase activity; oxidoreductase activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen. Biological Process: adrenal gland development; angiogenesis; arachidonic acid metabolic process; aromatic compound metabolic process; benzene and derivative metabolic process; blood vessel morphogenesis; cell adhesion; collagen fibril organization; dibenzo-p-dioxin metabolic process; DNA modification; endothelial cell migration; estrogen metabolic process; induction of apoptosis by oxidative stress; inhibition of NF-kappaB transcription factor; male gonad development; membrane lipid catabolic process; negative regulation of cell adhesion mediated by integrin; negative regulation of cell migration; negative regulation of cell proliferation; nitric oxide biosynthetic process; positive regulation of angiogenesis; positive regulation of apoptosis; positive regulation of JAK-STAT cascade; positive regulation of smooth muscle cell migration; positive regulation of translation; response to arsenic; response to estradiol stimulus; response to follicle-stimulating hormone stimulus; response to nutrient; response to organic cyclic substance; response to organic substance; response to steroid hormone stimulus; response to toxin; retinal metabolic process; retinol metabolic process; steroid metabolic process; toxin metabolic process; xenobiotic metabolic process

size1 :

0.01 mg (E-Coli)

price1 :

110 USD

size2 :

0.05 mg (E-Coli)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.5 mg (E-Coli)

price4 :

750

size5 :

1 mg (E-Coli)

price5 :

1180

more info or order :

MyBioSource product webpage