catalog number :
MBS1325135
products type :
Recombinant Protein
products full name :
Recombinant Human Ecto-NOX disulfide-thiol exchanger 1 (ENOX1)
products short name :
[Ecto-NOX disulfide-thiol exchanger 1 (ENOX1)]
products name syn :
[Ecto-NOX disulfide-thiol exchanger 1; Candidate growth-related and time keeping constitutive hydroquinone [NADH] oxidase; cCNOX; Cell proliferation-inducing gene 38 protein; Constitutive Ecto-NOX; cNOX; Including the following 2 domains:; Hydroquinone [NA]
other names :
[ecto-NOX disulfide-thiol exchanger 1; Ecto-NOX disulfide-thiol exchanger 1; ecto-NOX disulfide-thiol exchanger 1; constitutive Ecto-NOX; cell proliferation-inducing gene 38 protein; candidate growth-related and time keeping constitutive hydroquinone (NADH) oxidase; candidate growth-related and time keeping constitutive hydroquinone [NADH] oxidase; ecto-NOX disulfide-thiol exchanger 1; Candidate growth-related and time keeping constitutive hydroquinone [NADH] oxidase; cCNOX; Cell proliferation-inducing gene 38 protein; Constitutive Ecto-NOX; cNOX]
products gene name :
[ENOX1]
products gene name syn :
[ENOX1; PIG38]
other gene names :
[ENOX1; ENOX1; CNOX; PIG38; cCNOX; bA64J21.1; cCNOX; cNOX]
uniprot entry name :
ENOX1_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-643aa; Full Length]
sequence :
MVDAGGVENITQLPQELPQMMAAAADGLGSIAIDTTQLN
MSVTDPTAWATAMNNLGMVPVGLPGQQLVSDSICVPGFD
PSLNMMTGITPINPMIPGLGLVPPPPPTEVAVVKEIIHC
KSCTLFPQNPNLPPPSTRERPPGCKTVFVGGLPENATEE
IIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYL
SGYRMRLGSSTDKKDSGRLHVDFAQARDDFYEWECKQRM
RAREERHRRKLEEDRLRPPSPPAIMHYSEHEAALLAEKL
KDDSKFSEAITVLLSWIERGEVNRRSANQFYSMVQSANS
HVRRLMNEKATHEQEMEEAKENFKNALTGILTQFEQIVA
VFNASTRQKAWDHFSKAQRKNIDIWRKHSEELRNAQSEQ
LMGIRREEEMEMSDDENCDSPTKKMRVDESALAAQAYAL
KEENDSLRWQLDAYRNEVELLKQEKEQLFRTEENLTKDQ
QLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSH
TQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVAL
VNQDRENNIEKRSQGLKSEKEALLIGIISTFLHVHPFGA
NIEYLWSYMQQLDSKISANEIEMLLMRLPRMFKQEFTGV
GATLEKRWKLCAFEGIKTT
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-PAGE
other info1 :
Species: Homo sapiens (Human)
products description :
Probably acts as a terminal oxidase of plasma electron transport from cytosolic NAD(P)H via hydroquinones to acceptors at the cell surface. Hydroquinone oxidase activity alternates with a protein disulfide-thiol interchange/oxidoreductase activity which may control physical membrane displacements associated with vesicle budding or cell enlargement. The activities oscillate with a period length of 24 minutes and play a role in control of the ultradian cellular biological clock.
ncbi acc num :
NP_001121087.1
ncbi gb acc num :
NM_001127615.1
ncbi mol weight :
73,348 Da
ncbi summary :
Electron transport pathways are generally associated with mitochondrial membranes, but non-mitochondrial pathways are also biologically significant. Plasma membrane electron transport pathways are involved in functions as diverse as cellular defense, intracellular redox homeostasis, and control of cell growth and survival. Members of the ecto-NOX family, such as CNOX, or ENOX1, are involved in plasma membrane transport pathways. These enzymes exhibit both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity in series, with each activity cycling every 22 to 26 minutes (Scarlett et al., 2005 [PubMed 15882838]).[supplied by OMIM, Mar 2008]
uniprot summary :
PIG38: contains a RRM_1 domain which is found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. Protein type: RNA-binding; EC 1.-.-.-; Oxidoreductase. Chromosomal Location of Human Ortholog: 13q14.11. Cellular Component: extracellular space; plasma membrane. Molecular Function: nucleic acid binding; nucleotide binding; oxidoreductase activity. Biological Process: rhythmic process