catalog number :
MBS1325110
products type :
Recombinant Protein
products full name :
Recombinant Human Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3), partial
products short name :
[Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3)]
products name syn :
[Killer cell immunoglobulin-like receptor 2DS3; MHC class I NK cell receptor; Natural killer-associated transcript 7; NKAT-7]
other names :
[killer cell immunoglobulin-like receptor 2DS3; Killer cell immunoglobulin-like receptor 2DS3; killer cell immunoglobulin-like receptor 2DS3; NKAT-7; MHC class I NK cell receptor; natural killer-associated transcript 7; natural killer cell inhibitory receptor; killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 3; MHC class I NK cell receptor; Natural killer-associated transcript 7; NKAT-7]
products gene name :
[KIR2DS3]
products gene name syn :
[KIR2DS3; NKAT7]
other gene names :
[KIR2DS3; KIR2DS3; NKAT7; NKAT7; NKAT-7]
uniprot entry name :
KI2S3_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[22-245. Partial,provide the complete extracellular domain.]
sequence :
HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYR
CYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPT
VLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKV
NGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPL
LVSVTGNPSNSWPSPTEPSSKTGNPRHLH
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-PAGE
other info1 :
Species: Homo sapiens (Human)
other info2 :
Production Note: Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
ncbi acc num :
NP_036445.1
ncbi gb acc num :
NM_012313.1
ncbi mol weight :
33,717 Da
ncbi pathways :
Adaptive Immune System Pathway (366160); Antigen Processing And Presentation Pathway (83074); Antigen Processing And Presentation Pathway (485); DAP12 Interactions Pathway (685549); Immune System Pathway (106386); Immunoregulatory Interactions Between A Lymphoid And A Non-Lymphoid Cell Pathway (106413); Innate Immune System Pathway (106387); Natural Killer Cell Mediated Cytotoxicity Pathway (83079); Natural Killer Cell Mediated Cytotoxicity Pathway (490)
ncbi summary :
Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. [provided by RefSeq, Jul 2008]
uniprot summary :
KIR2DS3: Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells. Belongs to the immunoglobulin superfamily. Protein type: Membrane protein, integral. Chromosomal Location of Human Ortholog: 19q13.4. Cellular Component: integral to plasma membrane. Biological Process: cellular defense response
size4 :
0.01 mg (Baculovirus)
size6 :
0.02 mg (Baculovirus)
size11 :
0.05 mg (Baculovirus)
size12 :
0.1 mg (Baculovirus)
size15 :
0.05 mg (Mammalian-Cell)
size16 :
0.5 mg (Baculovirus)
size19 :
1 mg (Baculovirus)
size20 :
0.1 mg (Mammalian-Cell)