Recombinant Arachis hypogaea (Peanut) Conglutin-7 | MyBioSource MBS1325068 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Arachis hypogaea (Peanut) Conglutin-7

catalog :

MBS1325068

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1325068

products type :

Recombinant Protein

products full name :

Recombinant Arachis hypogaea (Peanut) Conglutin-7

products short name :

Conglutin-7

other names :

Conglutin-7; Conglutin-7; 2S protein 1

uniprot entry name :

CONG7_ARAHY

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

22-172

sequence length :

172

sequence :

RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSY
GRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQH
QERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQE
QQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Weak inhibitor of trypsin.

products references :

Isolation and characterization of two complete Ara h 2 isoforms cDNA.Chatel J.-M., Bernard H., Orson F.M.Int. Arch. Allergy Immunol. 131:14-18(2003) Isolation of peanut genes encoding arachins and conglutins by expressed sequence tags.Yan Y.-S., Lin X.-D., Zhang Y.-S., Wang L., Wu K., Huang S.-Z.Plant Sci. 169:439-445(2005) Isolation of peanut genes encoding arachins and conglutins by expressed sequence tags.Yan Y.-S., Lin X.-D., Zhang Y.-S., Wang L., Wu K., Huang S.-Z.Plant Sci. 169:439-445(2005) . Isolation of peanut genes encoding arachins and conglutins by expressed sequence tags.Yan Y.-S., Lin X.-D., Zhang Y.-S., Wang L., Wu K., Huang S.-Z.Plant Sci. 169:439-445(2005) . Chromosomal and phylogenetic context for conglutin genes in Arachis based on genomic sequence.Ramos M.L., Fleming G., Chu Y., Akiyama Y., Gallo M., Ozias-Akins P.Mol. Genet. Genomics 275:578-592(2006) Chromosomal and phylogenetic context for conglutin genes in Arachis based on genomic sequence.Ramos M.L., Fleming G., Chu Y., Akiyama Y., Gallo M., Ozias-Akins P.Mol. Genet. Genomics 275:578-592(2006) . cDNA cloning of peanut seed storage protein.Yan Y.-S., Wang L., Liao B., Li H., Lin X.-D., Huang S.-Z. cDNA cloning of peanut seed storage protein.Yan Y.-S., Wang L., Liao B., Li H., Lin X.-D., Huang S.-Z. Isolation of peanut genes encoding seed storage proteins and stress proteins from developing cotyledons by expressed sequence tags.Fu G., Yan Y.-S., Wang L., Zhong Y., Huang S.-Z. Isolation of peanut genes encoding seed storage proteins and stress proteins from developing cotyledons by expressed sequence tags.Fu G., Yan Y.-S., Wang L., Zhong Y., Huang S.-Z. Cloning and characterization of four genes encoding peanut seed oleosins.Li C., Fu G., Zhong Y., Yan Y., Wang L., Huang S. Cloning and characterization of four genes encoding peanut seed oleosins.Li C., Fu G., Zhong Y., Yan Y., Wang L., Huang S. Proteolytical processing of Ara h 2 into mature form.Radosavljevic J., Dobrijevic D., Blanusa M., Jadranin M., Cirkovic Velickovic T.Isolation and molecular characterization of the first genomic clone of a major peanut allergen, Ara h 2.Viquez O.M., Summer C.G., Dodo H.W.J. Allergy Clin. Immunol. 107:713-717(2001) Isolation and molecular characterization of the first genomic clone of a major peanut allergen, Ara h 2.Viquez O.M., Summer C.G., Dodo H.W.J. Allergy Clin. Immunol. 107:713-717(2001) . Isolation and molecular characterization of the first genomic clone of a major peanut allergen, Ara h 2.Viquez O.M., Summer C.G., Dodo H.W.J. Allergy Clin. Immunol. 107:713-717(2001) . Seed-specific, developmentally regulated genes of peanut.Paik-Ro O.G., Seib J.C., Smith R.L.Theor. Appl. Genet. 104:236-240(2002) Seed-specific, developmentally regulated genes of peanut.Paik-Ro O.G., Seib J.C., Smith R.L.Theor. Appl. Genet. 104:236-240(2002) . Re-investigation of the major peanut allergen Arah2 on the molecular level.Becker W.-M., Suhr M., Lindner B., Wicklein D., Lepp U.Primary sequence and site-selective hydroxylation of prolines in isoforms of a major peanut allergen protein Ara h 2.Li J., Shefcheck K., Callahan J., Fenselau C.Protein Sci. 19:174-182(2010) Suppression of seed storage proteins upon water stress in Arachis hypogea var. M-13 seeds.Katam R., Vasanthaiah H.K.N., Basha S.M., McClung S.Submitted (MAR-2007) to UniProtKB Suppression of seed storage proteins upon water stress in Arachis hypogea var. M-13 seeds.Katam R., Vasanthaiah H.K.N., Basha S.M., McClung S.Submitted (MAR-2007) to UniProtKB. Suppression of seed storage proteins upon water stress in Arachis hypogea var. M-13 seeds.Katam R., Vasanthaiah H.K.N., Basha S.M., McClung S.Submitted (MAR-2007) to UniProtKB. Structure and stability of 2S albumin-type peanut allergens implications for the severity of peanut allergic reactions.Lehmann K., Schweimer K., Reese G., Randow S., Suhr M., Becker W.-M., Vieths S., Roesch P.Biochem. J. 395:463-472(2006) The major peanut allergen, Ara h 2, functions as a trypsin inhibitor, and roasting enhances this function.Maleki S.J., Viquez O.M., Jacks T., Dodo H.W., Champagne E.T., Chung S.-Y., Landry S.J.J. Allergy Clin. Immunol. 112:190-195(2003)

ncbi gi num :

147639154

ncbi acc num :

Q6PSU2.2

uniprot acc num :

Q6PSU2

ncbi mol weight :

22.1kD

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

890

size5 :

0.05 mg (Mammalian-Cell)

price5 :

1115

more info or order :

MyBioSource product webpage