product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Histone deacetylase complex subunit SAP130
catalog :
MBS1324934
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1324934
products type :
Recombinant Protein
products full name :
Recombinant Mouse Histone deacetylase complex subunit SAP130
products short name :
Histone deacetylase complex subunit SAP130
products name syn :
130 kDa Sin3-associated polypeptide; Sin3-associated polypeptide p130
other names :
histone deacetylase complex subunit SAP130; Histone deacetylase complex subunit SAP130; histone deacetylase complex subunit SAP130; Sin3A associated protein; 130 kDa Sin3-associated polypeptide; Sin3-associated polypeptide p130
products gene name :
Sap130
other gene names :
Sap130; Sap130; 6720406D06; 2610304F09Rik
uniprot entry name :
SP130_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
845 – 1057;Interactions with SIN3A and HDAC1 region.
sequence length :
1057
sequence :
PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRK
SPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHH
FQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCA
AQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRI
NELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLL
NKNGTVKKVSKLKRKEKV
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Mus musculus (Mouse)
products description :
Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes
products references :
The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y. Science 309:1559-1563(2005)
ncbi gi num :
27881435
ncbi acc num :
NP_766553.1
ncbi gb acc num :
NM_172965.2
uniprot acc num :
Q8BIH0
ncbi mol weight :
28.87kD
uniprot summary :
SAP130: Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. Belongs to the SAP130 family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Transcription factor; Acetyltransferase. Cellular Component: nucleoplasm; nucleus. Molecular Function: histone acetyltransferase activity; protein binding; transcription coactivator activity. Biological Process: negative regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; transcription, DNA-dependent
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.05 mg (Yeast)
price2 :
260
size3 :
0.2 mg (E-Coli)
price3 :
490
size4 :
0.2 mg (Yeast)
price4 :
600
size5 :
0.5 mg (E-Coli)
price5 :
715
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!