catalog number :
MBS1321921
products type :
Recombinant Protein
products full name :
Recombinant Mouse Mucosal addressin cell adhesion molecule 1
products short name :
Mucosal addressin cell adhesion molecule 1
products name syn :
MAdCAM-1; mMAdCAM-1
other names :
PREDICTED: mucosal addressin cell adhesion molecule 1 isoform X1; Mucosal addressin cell adhesion molecule 1; mucosal addressin cell adhesion molecule 1; mucosal vascular addressin cell adhesion molecule 1
products gene name :
Madcam1
other gene names :
Madcam1; Madcam1; AV211525; MAdCAM-1; mMAdCAM-1
uniprot entry name :
MADCA_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
22-364
sequence :
QSFQVNPPESEVAVAMGTSLQITCSMSCDEGVARVHWRG
LDTSLGSVQTLPGSSILSVRGMLSDTGTPVCVGSCGSRS
FQHSVKILVYAFPDQLVVSPEFLVPGQDQVVSCTAHNIW
PADPNSLSFALLLGEQRLEGAQALEPEQEEEIQEAEGTP
LFRMTQRWRLPSLGTPAPPALHCQVTMQLPKLVLTHRKE
IPVLQSQTSPKPPNTTSAEPYILTSSSTAEAVSTGLNIT
TLPSAPPYPKLSPRTLSSEGPCRPKIHQDLEAGWELLCE
ASCGPGVTVRWTLAPGDLATYHKREAGAQAWLSVLPPGP
MVEGWFQCRQDPGGEVTNLYVPGQVTPNSSS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Mus musculus (Mouse)
products categories :
Immunology
products description :
Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Both isoform 1 and isoform 2 can adhere to integrin alpha-4/beta-7. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.
products references :
MAdCAM-1 has homology to immunoglobulin and mucin-like adhesion receptors and to IgA1."
Briskin M.J., McEvoy L.M., Butcher E.C.
Nature 363:461-464(1993)
ncbi acc num :
XP_006513356.1
ncbi gb acc num :
XM_006513293.2
ncbi mol weight :
52.78kD
ncbi pathways :
Adaptive Immune System Pathway (1323640); Cell Adhesion Molecules (CAMs) Pathway (83266); Cell Adhesion Molecules (CAMs) Pathway (480); Extracellular Matrix Organization Pathway (1323909); Immune System Pathway (1323639); Immunoregulatory Interactions Between A Lymphoid And A Non-Lymphoid Cell Pathway (1323669); Integrin Cell Surface Interactions Pathway (1323925); Intestinal Immune Network For IgA Production Pathway (128761); Intestinal Immune Network For IgA Production Pathway (128670)
uniprot summary :
MADCAM1: Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L- selectin binding. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Motility/polarity/chemotaxis. Cellular Component: integral to membrane; membrane. Biological Process: cell adhesion; cell-matrix adhesion; heterotypic cell-cell adhesion; integrin-mediated signaling pathway; keratinocyte differentiation; leukocyte migration; leukocyte tethering or rolling; positive regulation of leukocyte migration