Recombinant Human Poliovirus receptor-related protein 2 (PVRL2) | MyBioSource MBS1320948 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Poliovirus receptor-related protein 2 (PVRL2)

catalog :

MBS1320948

quantity :

0.01 mg (E-Coli)

price :

160 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS1320948

products type :

Recombinant Protein

products full name :

Recombinant Human Poliovirus receptor-related protein 2 (PVRL2)

products short name :

[Poliovirus receptor-related protein 2 (PVRL2)]

products name syn :

[Poliovirus receptor-related protein 2; Herpes virus entry mediator B; Herpesvirus entry mediator B; HveB; Nectin-2; CD_antigen=; CD112]

other names :

[nectin-2 isoform delta; Nectin-2; nectin-2; poliovirus receptor-like 2; herpesvirus entry protein B; poliovirus receptor-related 2 (herpesvirus entry mediator B); Herpes virus entry mediator B; Herpesvirus entry mediator B; HveB; Poliovirus receptor-related protein 2; CD_antigen: CD112]

products gene name :

[PVRL2]

products gene name syn :

[PVRL2; HVEB; PRR2]

other gene names :

[PVRL2; PVRL2; HVEB; PRR2; CD112; PVRR2; HVEB; PRR2; Herpesvirus entry mediator B; HveB]

uniprot entry name :

PVRL2_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

[32-360aa; Extracellular Domain]

sequence length :

360

sequence :

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTW
QRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAK
QSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKG
SVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKE
GRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLV
PSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSI
SGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFP
TSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQV
IFVRETPNTAGAGATGG

purity :

>=90%

form :

Liquid containing glycerol

storage stability :

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

image1 heading :

SDS-PAGE

other info1 :

Species: Homo sapiens (Human)

products categories :

Immunology

products description :

Probable cell adhesion protein.

ncbi gi num :

112789532

ncbi acc num :

NP_001036189.1

ncbi gb acc num :

NM_001042724.1

uniprot acc num :

Q92692

ncbi mol weight :

51,359 Da

ncbi pathways :

Adaptive Immunity Signaling Pathway (366160); Adherens Junction Pathway (83070); Adherens Junction Pathway (481); Adherens Junctions Interactions Pathway (119533); Cell Adhesion Molecules (CAMs) Pathway (83069); Cell Adhesion Molecules (CAMs) Pathway (480); Cell Junction Organization Pathway (160966); Cell-cell Junction Organization Pathway (119532); Immune System Pathway (106386); Immunoregulatory Interactions Between A Lymphoid And A Non-Lymphoid Cell Pathway (106413)

ncbi summary :

This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

uniprot summary :

nectin 2: Probable cell adhesion protein. Belongs to the nectin family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Cell adhesion; Membrane protein, integral. Chromosomal Location of Human Ortholog: 19q13.2. Cellular Component: focal adhesion; cell surface; integral to membrane; plasma membrane; intercellular junction; zonula adherens. Molecular Function: viral receptor activity; identical protein binding; protein binding; protein homodimerization activity; coreceptor activity; cell adhesion molecule binding. Biological Process: acrosome formation; establishment of mitochondrion localization; intercellular junction assembly and maintenance; regulation of immune response; sperm mitochondrion organization and biogenesis; positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target; positive regulation of immunoglobulin mediated immune response; spermatid nuclear differentiation; cytoskeleton organization and biogenesis; susceptibility to natural killer cell mediated cytotoxicity; positive regulation of natural killer cell mediated cytotoxicity; virion attachment, binding of host cell surface coreceptor; signal transduction; positive regulation of mast cell activation; viral envelope fusion with host membrane; fertilization; cell part morphogenesis; adhesion to host; homophilic cell adhesion; spermatid development

size1 :

0.01 mg (E-Coli)

price1 :

160 USD

size2 :

0.05 mg (E-Coli)

price2 :

200

size3 :

0.1 mg (E-Coli)

price3 :

295

size4 :

0.2 mg (E-Coli)

price4 :

480

size5 :

0.5 mg (E-Coli)

price5 :

790

size6 :

1 mg (E-Coli)

price6 :

1215

more info or order :

MyBioSource product webpage