protein

Recombinant Mouse E3 ubiquitin-protein ligase TRIM21

MBS1316666

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Mouse E3 ubiquitin-protein ligase TRIM21

E3 ubiquitin-protein ligase TRIM21

52 kDa Ro protein; 52 kDa ribonucleoprotein autoantigen Ro/SS-A; Ro(SS-A); Sjoegren syndrome type A antigen; SS-A; Tripartite motif-containing protein 21

E3 ubiquitin-protein ligase TRIM21; E3 ubiquitin-protein ligase TRIM21; E3 ubiquitin-protein ligase TRIM21; tripartite motif-containing 21; 52 kDa Ro protein; 52 kDa ribonucleoprotein autoantigen Ro/SS-A; Ro(SS-A); Sjoegren syndrome type A antigen; SS-A; Tripartite motif-containing protein 21

Trim21

Trim21; Trim21; Ro52; Ssa1; Ro52; Ssa1; SS-A

RO52_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

1-470

470

MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCF
CKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVE
NLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWV
CAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKEL
AEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQ
EEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELIS
ELERRIRGSELELLQEVRIIL

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

E3 ubiquitin-protein ligase whose activity is dependent on E2 enzymes, UBE2D1, UBE2D2, UBE2E1 and UBE2E2. Forms a ubiquitin ligase complex in cooperation with the E2 UBE2D2 that is used not only for the ubiquitination of USP4 and IKBKB but also for its self-ubiquitination. Component of cullin-RING-based SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes such as SCF(SKP2)-like complexes. A TRIM21-containing SCF(SKP2)-like complex is shown to mediate ubiquitination of CDKN1B ('Thr-187' phosphorylated-form), thereby promoting its degradation by the proteasome. Monoubiquitinates IKBKB that will negatively regulates Tax-induced NF-kappa-B signaling. Negatively regulates IFN-beta production post-pathogen recognition by polyubiquitin-mediated degradation of IRF3. Mediates the ubiquitin-mediated proteasomal degradation of IgG1 heavy chain, which is linked to the VCP-mediated ER-associated degradation (ERAD) pathway. Promotes IRF8 ubiquitination, which enhanced the ability of IRF8 to stimulate cytokine genes transcription in macrophages. Plays a role in the regulation of the cell cycle progression. Enhances the decapping activity of DCP2. Exists as a ribonucleoprotein particle present in all mammalian cells studied and composed of a single polypeptide and one of four small RNA molecules. At least two isoforms are present in nucleated and red blood cells, and tissue specific differences in RO/SSA proteins have been identified. The common feature of these proteins is their ability to bind HY RNAs. 2.

Structural differences between the human and mouse 52-kD Ro autoantigens associated with poorly conserved autoantibody activity across species.Keech C.L., Gordon T.P., McCluskey J.Clin. Exp. Immunol. 104:255-263(1996) Autoantigen Ro52 is an interferon inducible E3 ligase that ubiquitinates IRF-8 and enhances cytokine expression in macrophages.Kong H.J., Anderson D.E., Lee C.H., Jang M.K., Tamura T., Tailor P., Cho H.K., Cheong J., Xiong H., Morse H.C. III, Ozato K.J. Immunol. 179:26-30(2007)

3024571

Q62191.1

Q62191

70.14kD

Adaptive Immune System Pathway (1323640); Antigen Processing: Ubiquitination Proteasome Degradation Pathway (1323663); Class I MHC Mediated Antigen Processing Presentation Pathway (1323662); Cytosolic Sensors Of Pathogen-associated DNA Pathway (1323730); Immune System Pathway (1323639); Innate Immune System Pathway (1323671); Regulation Of Innate Immune Responses To Cytosolic DNA Pathway (1323739); Systemic Lupus Erythematosus Pathway (83315); Systemic Lupus Erythematosus Pathway (534); MRNA Processing Pathway (198369)

TRIM21: E3 ubiquitin-protein ligase whose activity is dependent on E2 enzymes, UBE2D1, UBE2D2, UBE2E1 and UBE2E2. Forms a ubiquitin ligase complex in cooperation with the E2 UBE2D2 that is used not only for the ubiquitination of USP4 and IKBKB but also for its self-ubiquitination. Component of cullin-RING-based SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes such as SCF(SKP2)-like complexes. A TRIM21-containing SCF(SKP2)- like complex is shown to mediate ubiquitination of CDKN1B ('Thr- 187' phosphorylated-form), thereby promoting its degradation by the proteasome. Monoubiquitinates IKBKB that will negatively regulates Tax-induced NF-kappa-B signaling. Negatively regulates IFN-beta production post-pathogen recognition by polyubiquitin- mediated degradation of IRF3. Mediates the ubiquitin-mediated proteasomal degradation of IgG1 heavy chain, which is linked to the VCP-mediated ER-associated degradation (ERAD) pathway. Promotes IRF8 ubiquitination, which enhanced the ability of IRF8 to stimulate cytokine genes transcription in macrophages. Plays a role in the regulation of the cell cycle progression. Enhances the decapping activity of DCP2. Exists as a ribonucleoprotein particle present in all mammalian cells studied and composed of a single polypeptide and one of four small RNA molecules. At least two isoforms are present in nucleated and red blood cells, and tissue specific differences in RO/SSA proteins have been identified. The common feature of these proteins is their ability to bind HY RNAs.2. Belongs to the TRIM/RBCC family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Ligase; Ubiquitin ligase; EC 6.3.2.-; Ubiquitin conjugating system. Cellular Component: cytoplasm; cytoplasmic vesicle; intracellular; nucleus; ribonucleoprotein complex; SCF ubiquitin ligase complex. Molecular Function: coenzyme F420-0 gamma-glutamyl ligase activity; coenzyme F420-2 alpha-glutamyl ligase activity; DNA binding; identical protein binding; ligase activity; metal ion binding; protein binding; ribosomal S6-glutamic acid ligase activity; RNA binding; ubiquitin-protein ligase activity; UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanine ligase activity; zinc ion binding. Biological Process: cell cycle; inhibition of NF-kappaB transcription factor; innate immune response; negative regulation of viral transcription; positive regulation of autophagy; positive regulation of cell cycle; positive regulation of transcription factor activity; positive regulation of virion penetration into host cell; protein autoubiquitination; protein destabilization; protein monoubiquitination; protein polyubiquitination; protein ubiquitination

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180

0.05 mg (Baculovirus)

1250