Recombinant Human Mediator of DNA damage checkpoint protein 1 | MyBioSource MBS1312936 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Mediator of DNA damage checkpoint protein 1

catalog :

MBS1312936

quantity :

0.01 mg (E-Coli)

price :

145 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1312936

products type :

Recombinant Protein

products full name :

Recombinant Human Mediator of DNA damage checkpoint protein 1

products short name :

Mediator of DNA damage checkpoint protein 1

products name syn :

Nuclear factor with BRCT domains 1

other names :

mediator of DNA damage checkpoint protein 1; Mediator of DNA damage checkpoint protein 1; mediator of DNA damage checkpoint 1; Nuclear factor with BRCT domains 1

products gene name :

MDC1

other gene names :

MDC1; MDC1; NFBD1; KIAA0170; NFBD1

uniprot entry name :

MDC1_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1892-2082

sequence length :

2089

sequence :

APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDR
IRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYV
VTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQ
PPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFP
HCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

other info2 :

Species: Homo sapiens

products categories :

Epigenetics and Nuclear Signaling

products description :

Required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. May serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked by 'Ser-139' phosphorylation of histone H2AFX. Also required for downstream events subsequent to the recruitment of these proteins. These include phosphorylation and activation of the ATM, CHEK1 and CHEK2 kinases, and stabilization of TP53 and apoptosis. ATM and CHEK2 may also be activated independently by a parallel pathway mediated by TP53BP1.

products references :

53BP1 and NFBD1/MDC1-Nbs1 function in parallel interacting pathways activating ataxia-telangiectasia mutated (ATM) in response to DNA damage." Mochan T.A., Venere M., DiTullio R.A. Jr., Halazonetis T.D. Cancer Res. 63:8586-8591(2003)

ncbi gi num :

132626688

ncbi acc num :

NP_055456.2

ncbi gb acc num :

NM_014641.2

uniprot acc num :

Q14676

ncbi mol weight :

36.91kd

ncbi pathways :

Cell Cycle Pathway (1269741); Cell Cycle Checkpoints Pathway (1269742); DNA Double Strand Break Response Pathway (1309096); DNA Double-Strand Break Repair Pathway (1309095); DNA Repair Pathway (1270350); G2/M Checkpoints Pathway (1269753); G2/M DNA Damage Checkpoint Pathway (1269754); HDR Through Homologous Recombination (HR) Or Single Strand Annealing (SSA) Pathway (1309100); Homology Directed Repair Pathway (1309099); Metabolism Of Proteins Pathway (1268677)

ncbi summary :

The protein encoded by this gene contains an N-terminal forkhead domain, two BRCA1 C-terminal (BRCT) motifs and a central domain with 13 repetitions of an approximately 41-amino acid sequence. The encoded protein is required to activate the intra-S phase and G2/M phase cell cycle checkpoints in response to DNA damage. This nuclear protein interacts with phosphorylated histone H2AX near sites of DNA double-strand breaks through its BRCT motifs, and facilitates recruitment of the ATM kinase and meiotic recombination 11 protein complex to DNA damage foci. [provided by RefSeq, Jul 2008]

uniprot summary :

MDC1: Required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. May serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked by 'Ser-139' phosphorylation of histone H2AFX. Also required for downstream events subsequent to the recruitment of these proteins. These include phosphorylation and activation of the ATM, CHEK1 and CHEK2 kinases, and stabilization of TP53 and apoptosis. ATM and CHEK2 may also be activated independently by a parallel pathway mediated by TP53BP1. 4 isoforms of the human protein are produced by alternative splicing. Protein type: Cell cycle regulation. Chromosomal Location of Human Ortholog: 6p21.3. Cellular Component: chromosome; focal adhesion; nucleoplasm; nucleus. Molecular Function: protein binding; protein C-terminus binding. Biological Process: cellular protein metabolic process; DNA repair; double-strand break repair; double-strand break repair via homologous recombination; double-strand break repair via nonhomologous end joining; intra-S DNA damage checkpoint; post-translational protein modification; protein sumoylation

size1 :

0.01 mg (E-Coli)

price1 :

145 USD

size2 :

0.05 mg (E-Coli)

price2 :

205

size3 :

0.2 mg (E-Coli)

price3 :

520

size4 :

0.5 mg (E-Coli)

price4 :

850

size5 :

0.05 mg (Baculovirus)

price5 :

940

more info or order :

MyBioSource product webpage