Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial | MyBioSource MBS1307065 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial

catalog :

MBS1307065

quantity :

0.01 mg (E-Coli)

price :

200 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS1307065

products type :

Recombinant Protein

products full name :

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial

products short name :

[Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4)]

products name syn :

[Inter-alpha-trypsin inhibitor family heavy chain-related protein; IHRP; Plasma kallikrein sensitive glycoprotein 120; Gp120; PK-120]

other names :

[inter-alpha-trypsin inhibitor heavy chain H4 isoform 2; Inter-alpha-trypsin inhibitor heavy chain H4; inter-alpha-trypsin inhibitor heavy chain H4; inter-alpha-trypsin inhibitor heavy chain family member 4; Inter-alpha-trypsin inhibitor family heavy chain-related protein; IHRP]

products gene name :

[ITIH4]

other gene names :

[ITIH4; ITIH4; H4P; IHRP; GP120; PK120; ITIHL1; PK-120; ITI-HC4; IHRP; ITIHL1; PK120; ITI heavy chain H4; ITI-HC4; Inter-alpha-inhibitor heavy chain 4; IHRP; Gp120; PK-120]

uniprot entry name :

ITIH4_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

[689-930aa. Partial, 35 kDa inter-alpha-trypsin inhibitor heavy chain H4]

sequence :

RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPA
PIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQG
VEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTR
NRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVT
IGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVL
WGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVE
ISCWSVEL

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

image1 heading :

SDS-PAGE

other info2 :

Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.

products categories :

Immunology

products description :

Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.

products references :

cDNA and deduced amino acid sequence of human PK-120, a plasma kallikrein-sensitive glycoprotein.Nishimura H., Kakizaki I., Muta T., Sasaki N., Pu P.X., Yamashita T., Nagasawa S.FEBS Lett. 357:207-211(1995) Cloning and characterization of cDNA for inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP), a novel human plasma glycoprotein.Saguchi K., Tobe T., Hashimoto K., Sano Y., Nakano Y., Miura N.-H., Tomita M.J. Biochem. 117:14-18(1995) Isolation and characterization of the human inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP) gene (ITIHL1).Saguchi K., Tobe T., Hashimoto K., Nagasaki Y., Oda E., Nakano Y., Miura N.H., Tomita M.J. Biochem. 119:898-905(1996) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) BIP co-chaperone MTJ1/ERDJ1 interacts with inter-alpha-trypsin inhibitor heavy chain 4.Kroczynska B., King-Simmons L., Alloza L., Alava M.A., Elguindi E.C., Blond S.Y.Biochem. Biophys. Res. Commun. 338:1467-1477(2005) The DNA sequence, annotation and analysis of human chromosome 3.Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.Nature 440:1194-1198(2006) Functional prediction of the coding sequences of 79 new genes deduced by analysis of cDNA clones from human fetal liver.Zhang C., Yu Y., Zhang S., Wei H., Zhang Y., Zhou G., Bi J., Liu M., He F. Purification and characterization of a novel glycoprotein which has significant homology to heavy chains of inter-alpha-trypsin inhibitor family from human plasma.Choi-Miura N.-H., Sano Y., Oda E., Nakano Y., Tobe T., Yanagishita T., Taniyama M., Katagiri T., Tomita M.J. Biochem. 117:400-407(1995) Purification and characterization of a novel substrate for plasma kallikrein (PK-120) in human plasma.Pu X.P., Iwamoto A., Nishimura H., Nagasawa S.Biochim. Biophys. Acta 1208:338-343(1994) ITIH4 serum concentration increases during acute-phase processes in human patients and is up-regulated by interleukin-6 in hepatocarcinoma HepG2 cells.Pineiro M., Alava M.A., Gonzalez-Ramon N., Osada J., Lasierra P., Larrad L., Pineiro A., Lampreave F.Biochem. Biophys. Res. Commun. 263:224-229(1999) Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.Zhang H., Li X.-J., Martin D.B., Aebersold R.Nat. Biotechnol. 21:660-666(2003) Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R.Proteomics 4:454-465(2004) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005) Inter-alpha-trypsin inhibitor heavy chain 4 is a novel marker of acute ischemic stroke.Kashyap R.S., Nayak A.R., Deshpande P.S., Kabra D., Purohit H.J., Taori G.M., Daginawala H.F.Clin. Chim. Acta 402:160-163(2009) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) The absolute quantification of eight inter-alpha-trypsin inhibitor heavy chain 4 (ITIH4)-derived peptides in serum from breast cancer patients.van den Broek I., Sparidans R.W., van Winden A.W., Gast M.C., van Dulken E.J., Schellens J.H., Beijnen J.H.Proteomics Clin. Appl. 4:931-939(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD.Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G.Mol. Cell. Proteomics 0:0-0(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4.Chandler K.B., Brnakova Z., Sanda M., Wang S., Stalnaker S.H., Bridger R., Zhao P., Wells L., Edwards N.J., Goldman R.J. Proteome Res. 13:3314-3329(2014) SNP analysis of the inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP) gene by a fluorescence-adapted SSCP method.Tozaki T., Choi-Miura N.-H., Taniyama M., Kurosawa M., Tomita M.BMC Med. Genet. 3:6-6(2002)

ncbi gi num :

262050538

ncbi acc num :

NP_001159921.1

ncbi gb acc num :

NM_001166449.1

uniprot acc num :

Q14624

ncbi mol weight :

42.9kD

ncbi summary :

The protein encoded by this gene is secreted into the blood, where it is cleaved by plasma kallikrein into two smaller forms. Expression of this gene has been detected only in liver, and it seems to be upregulated during surgical trauma. This gene is part of a cluster of similar genes on chromosome 3. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]

uniprot summary :

ITIH4: May be involved in acute phase reactions. Belongs to the ITIH family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 3p21.1. Cellular Component: cytoplasm; extracellular region; plasma membrane. Molecular Function: endopeptidase inhibitor activity; protein binding; serine-type endopeptidase inhibitor activity. Biological Process: acute-phase response; hyaluronan metabolic process; response to cytokine stimulus. Disease: Hypercholesterolemia, Familial

size1 :

0.01 mg (E-Coli)

price1 :

200 USD

size2 :

0.01 mg (Yeast)

price2 :

230

size3 :

0.05 mg (E-Coli)

price3 :

260

size4 :

0.05 mg (Yeast)

price4 :

305

size5 :

0.1 mg (E-Coli)

price5 :

430

size6 :

0.1 mg (Yeast)

price6 :

510

size7 :

0.2 mg (E-Coli)

price7 :

685

size8 :

0.2 mg (Yeast)

price8 :

815

size9 :

0.05 mg (Baculovirus)

price9 :

995

size10 :

0.5 mg (E-Coli)

price10 :

1125

size11 :

0.05 mg (Mammalian-Cell)

price11 :

1235

size12 :

0.5 mg (Yeast)

price12 :

1345

size13 :

0.1 mg (Baculovirus)

price13 :

1440

size14 :

1 mg (E-Coli)

price14 :

1725

size15 :

0.5 mg (Baculovirus)

price15 :

1880

size16 :

0.1 mg (Mammalian-Cell)

price16 :

2015

size17 :

1 mg (Yeast)

price17 :

2065

size18 :

1 mg (Baculovirus)

price18 :

2920

more info or order :

MyBioSource product webpage