catalog number :
MBS1305261
products type :
Recombinant Protein
products full name :
Recombinant Staphylococcus aureus Alpha-hemolysin (hly)
products short name :
[Alpha-hemolysin]
products name syn :
[Alpha-toxin]
other names :
[alpha-hemolysin; Alpha-hemolysin; alpha-hemolysin; Alpha-toxin]
products gene name :
[hly]
other gene names :
[SAOUHSC_01121; hly; hla; Alpha-HL]
uniprot entry name :
HLA_STAA8
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[27-319aa; Full Length of Mature Protein]
sequence :
ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVF
YSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGL
AWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLT
YGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTI
LESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQL
FMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITM
DRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDK
WIDRSSERYKIDWEKEEMTN
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-Page
other info2 :
Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Alpha-toxin binds to the membrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Heptamer oligomerization and pore formation is required for lytic activity.
products references :
Synthetic effects of secG and secY2 mutations on exoproteome biogenesis in Staphylococcus aureus.Sibbald M.J., Winter T., van der Kooi-Pol M.M., Buist G., Tsompanidou E., Bosma T., Schafer T., Ohlsen K., Hecker M., Antelmann H., Engelmann S., van Dijl J.M.J. Bacteriol. 192:3788-3800(2010)
ncbi acc num :
WP_000857483.1
ncbi gb acc num :
WP_000857483.1
uniprot summary :
Alpha-toxin binds to the membrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Heptamer oligomerization and pore formation is required for lytic activity ().