IFSKIGETLGQLFRHRAPDSAPGRVRLQGVRYVGSYRPT
GDAKQAIRHFVDEAVKQVAHTRTPEIRQDAEFGRQVYEA
TLCAIFSEAKDRFCMDPATRAGNVRPAFIEALGDAARAT
GLPGADKQGVFTPSGAGTNPLYTEIRLRADTLMGAELAA
RPEYRELQPYARQQAIDLVANALPAERSNTLVEFRQTVQ
TLEATYRRAAQDASRDEKGATNAADGA

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Human Proline-rich protein 11 | MBS1311505
- Recombinant Human Mediator of DNA damage checkpoint protein 1 | MBS1312936
- Recombinant Mouse E3 ubiquitin-protein ligase TRIM21 | MBS1316666
- Recombinant Mouse Mucosal addressin cell adhesion molecule 1 | MBS1321921
- Recombinant Rat Cytochrome P450 1B1 | MBS1325163
