catalog number :
MBS1292509
products type :
Recombinant Protein
products full name :
Recombinant Mouse Interleukin-1 receptor-associated kinase 4 (Irak4)
products short name :
[Interleukin-1 receptor-associated kinase 4 (Irak4)]
other names :
[interleukin-1 receptor-associated kinase 4; Interleukin-1 receptor-associated kinase 4; interleukin-1 receptor-associated kinase 4; interleukin-1 receptor-associated kinase 4]
products gene name :
[Irak4]
products gene name syn :
[Irak4]
other gene names :
[Irak4; Irak4; IRAK-4; NY-REN-64; 8430405M07Rik; 9330209D03Rik; IRAK-4]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-459. Full Length]
sequence :
MNKPLTPSTYIRNLNVGILRKLSDFIDPQEGWKKLAVAI
KKPSGDDRYNQFHIRRFEALLQTGKSPTCELLFDWGTTN
CTVGDLVDLLVQIELFAPATLLLPDAVPQTVKSLPPREA
ATVAQTHGPCQEKDRTSVMPMPKLEHSCEPPDSSSPDNR
SVESSDTRFHSFSFHELKSITNNFDEQPASAGGNRMGEG
GFGVVYKGCVNNTIVAVKKLGAMVEISTEELKQQFDQEI
KVMATCQHENLVELLGFSSDSDNLCLVYAYMPNGSLLDR
LSCLDGTPPLSWHTRCKVAQGTANGIRFLHENHHIHRDI
KSANILLDKDFTAKISDFGLARASARLAQTVMTSRIVGT
TAYMAPEALRGEITPKSDIYSFGVVLLELITGLAAVDEN
REPQLLLDIKEEIEDEEKTIEDYTDEKMSDADPASVEAM
YSAASQCLHEKKNRRPDIAKVQQLLQEMSA
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Mouse
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol
ncbi acc num :
NP_084202.2
ncbi gb acc num :
NM_029926.5
ncbi mol weight :
50,872 Da
ncbi pathways :
Apoptosis Pathway (83257); Apoptosis Pathway (470); Apoptosis Signaling Pathway (522973); Chagas Disease (American Trypanosomiasis) Pathway (147810); Chagas Disease (American Trypanosomiasis) Pathway (147795); IL-1 Signaling Pathway (198360); Immune System Pathway (575095); Influenza A Pathway (217174); Influenza A Pathway (217150); Innate Immune System Pathway (575115)
uniprot summary :
Serine/threonine-protein kinase that plays a critical role in initiating innate immune response against foreign pathogens. Involved in Toll-like receptor (TLR) and IL-1R signaling pathways. Is rapidly recruited by MYD88 to the receptor-signaling complex upon TLR activation to form the Myddosome together with IRAK2. Phosphorylates initially IRAK1, thus stimulating the kinase activity and intensive autophosphorylation of IRAK1. Phosphorylates E3 ubiquitin ligases Pellino proteins (PELI1, PELI2 and PELI3) to promote pellino-mediated polyubiquitination of IRAK1. Then, the ubiquitin-binding domain of IKBKG/NEMO binds to polyubiquitinated IRAK1 bringing together the IRAK1-MAP3K7/TAK1-TRAF6 complex and the NEMO-IKKA-IKKB complex. In turn, MAP3K7/TAK1 activates IKKs (CHUK/IKKA and IKBKB/IKKB) leading to NF-kappa-B nuclear translocation and activation. Alternatively, phosphorylates TIRAP to promote its ubiquitination and subsequent degradation. Phosphorylates NCF1 and regulates NADPH oxidase activation after LPS stimulation suggesting a similar mechanism during microbial infections ().
size4 :
0.05 mg (Baculovirus)
size7 :
0.05 mg (Mammalian-Cell)
size9 :
0.1 mg (Baculovirus)
size11 :
0.5 mg (Baculovirus)
size12 :
0.1 mg (Mammalian-Cell)
size14 :
1 mg (Baculovirus)