Recombinant Norwalk virus Capsid protein VP1 (ORF2) | MyBioSource MBS1291347 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Norwalk virus Capsid protein VP1 (ORF2)

catalog :

MBS1291347

quantity :

0.01 mg (Mammalian-Cell)

price :

225 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1291347

products type :

Recombinant Protein

products full name :

Recombinant Norwalk virus Capsid protein VP1 (ORF2)

products short name :

[Norwalk virus Capsid protein VP1 (ORF2)]

products name syn :

[p59]

other names :

[58 kd capsid protein; Capsid protein VP1; 58 kd capsid protein; p59]

products gene name :

[ORF2]

other gene names :

[NVgp2; ORF2; CP; p30]

uniprot entry name :

CAPSD_NVN68

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

[1-530aa; Full Length]

sequence length :

530

sequence :

MMMASKDATSSVDGASGAGQLVPEVNASDPLAMDPVAGS
STAVATAGQVNPIDPWIINNFVQAPQGEFTISPNNTPGD
VLFDLSLGPHLNPFLLHLSQMYNGWVGNMRVRIMLAGNA
FTAGKIIVSCIPPGFGSHNLTIAQATLFPHVIADVRTLD
PIEVPLEDVRNVLFHNNDRNQQTMRLVCMLYTPLRTGGG
TGDSFVVAGRVMTCPSPDFNFLFLVPPTVEQKTRPFTLP
NLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLD
GRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPF
EGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDT
FVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLW
KIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPG
AYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGR
NLGEFKAYPDGFLTCVPNGASSGPQQLPINGVFVFVSWV
SRFYQLKPVGTASSARGRLGLRR

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

image1 heading :

SDS-Page

other info2 :

Production Note: Special Offer: The Mammalian-Cell host-expressed protein is manufactured from a stock plasmid containing the protein gene. Mammalian-Cellhost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Mammalian-Cell host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Mammalian-Cell host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.

products description :

Capsid protein self assbles to form an icosahedral capsid with a T=3 symmetry, about 38 nm in diameter, and consisting of 180 capsid proteins. A smaller form of capsid with a diameter of 23 nm might be capsid proteins assbled as icosahedron with T=1 symmetry. The capsid encapsulate the genomic RNA and VP2 proteins. Attaches virion to target cells by binding histo-blood group antigens present on gastroduodenal epithelial cells.

products references :

Sequence and genomic organization of Norwalk virus.Jiang X., Wang M., Wang K., Estes M.K.Virology 195:51-61(1993) Specific proteolytic cleavage of recombinant Norwalk virus capsid protein.Hardy M.E., White L.J., Ball J.M., Estes M.K.J. Virol. 69:1693-1698(1995) Attachment and entry of recombinant Norwalk virus capsids to cultured human and animal cell lines.White L.J., Ball J.M., Hardy M.E., Tanaka T.N., Kitamoto N., Estes M.K.J. Virol. 70:6589-6597(1996) Biochemical characterization of a smaller form of recombinant Norwalk virus capsids assembled in insect cells.White L.J., Hardy M.E., Estes M.K.J. Virol. 71:8066-8072(1997) Norwalk virus binds to histo-blood group antigens present on gastroduodenal epithelial cells of secretor individuals.Marionneau S., Ruvoen N., Le Moullac-Vaidye B., Clement M., Cailleau-Thomas A., Ruiz-Palacois G., Huang P., Jiang X., Le Pendu J.Gastroenterology 122:1967-1977(2002) The 3' end of Norwalk virus mRNA contains determinants that regulate the expression and stability of the viral capsid protein VP1 a novel function for the VP2 protein.Bertolotti-Ciarlet A., Crawford S.E., Hutson A.M., Estes M.K.J. Virol. 77:11603-11615(2003) Noroviruses bind to human ABO, Lewis, and secretor histo-blood group antigens identification of 4 distinct strain-specific patterns.Huang P., Farkas T., Marionneau S., Zhong W., Ruvoen-Clouet N., Morrow A.L., Altaye M., Pickering L.K., Newburg D.S., LePendu J., Jiang X.J. Infect. Dis. 188:19-31(2003) C-terminal arginine cluster is essential for receptor binding of norovirus capsid protein.Tan M., Meller J., Jiang X.J. Virol. 80:7322-7331(2006) Norovirus protein structure and function.Hardy M.E.FEMS Microbiol. Lett. 253:1-8(2005) X-ray crystallographic structure of the Norwalk virus capsid.Prasad B.V.V., Hardy M.E., Dokland T., Bella J., Rossmann M.G., Estes M.K.Science 286:287-290(1999)

ncbi gi num :

106060736

ncbi acc num :

NP_056821.2

ncbi gb acc num :

NC_001959.2

uniprot acc num :

Q83884

ncbi mol weight :

58.59kD

uniprot summary :

Capsid protein self assembles to form an icosahedral capsid with a T=3 symmetry, about 38 nm in diameter, and consisting of 180 capsid proteins. A smaller form of capsid with a diameter of 23 nm might be capsid proteins assembled as icosahedron with T=1 symmetry. The capsid encapsulate the genomic RNA and VP2 proteins. Attaches virion to target cells by binding histo-blood group antigens present on gastroduodenal epithelial cells.

size1 :

0.01 mg (Mammalian-Cell)

price1 :

225 USD

size2 :

0.02 mg (Mammalian-Cell)

price2 :

335

size3 :

0.05 mg (Mammalian-Cell)

price3 :

635

size4 :

0.1 mg (Mammalian-Cell)

price4 :

880

more info or order :

MyBioSource product webpage