RQSRSASQVRVPTVFHKKRVEPLTVPPAPKDICPTLKKG
FLCDSSFCKKDHQLESLTDRELLLLIARKTCGSVEQQLN
ITAPKDSRLANPTADDFQQEEGPKITLLTLIKTAEHWAR
QDIRTIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLR
REGLGQDQAEPVLEVYQRLHSDKGGSFEAALWQQWDRQS
LIMFITAFLNIALQLPCESSA

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Mouse 1,4-alpha-glucan-branching enzyme (Gbe1) | MBS1300493
- Recombinant Human Store-operated calcium entry-associated regulatory factor
- Recombinant Human Glutamate decarboxylase 1 (GAD1) | MBS1312638
- Recombinant Human Fc receptor-like protein 6 | MBS1313184
- Recombinant Staphylococcus aureus Staphylococcal secretory antigen ssaA2 (ssaA2)