product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Arabidopsis thaliana Protein ROS1 (ROS1), partial
catalog :
MBS1285940
quantity :
0.01 mg (E-Coli)
price :
235 USD
more info or order :
image
image 1 :
MyBioSource MBS1285940 image 1
product information
catalog number :
MBS1285940
products type :
Recombinant Protein
products full name :
Recombinant Arabidopsis thaliana Protein ROS1 (ROS1), partial
products short name :
[Protein ROS1 (ROS1), partial]
products name syn :
[Protein ROS1; EC=3.2.2.-; DEMETER-like protein 1; Repressor of silencing 1]
other names :
[protein ROS1; Protein ROS1; protein ROS1; DEMETER-like protein 1; Repressor of silencing 1]
products gene name :
[ROS1]
products gene name syn :
[ROS1; DML1; At2g36490; F1O11.12]
other gene names :
[DML1; ROS1; demeter-like 1; DML1; F1O11.12; F1O11_12; REPRESSOR OF SILENCING1; ROS1; DML1]
uniprot entry name :
ROS1_ARATH
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-320aa; Partial]
sequence :
MEKQRREESSFQQPPWIPQTPMKPFSPICPYTVEDQYHS
SQLEERRFVGNKDMSGLDHLSFGDLLALANTASLIFSGQ
TPIPTRNTEVMQKGTEEVESLSSVSNNVAEQILKTPEKP
KRKKHRPKVRREAKPKREPKPRAPRKSVVTDGQESKTPK
RKYVRKKVEVSKDQDATPVESSAAVETSTRPKRLCRRVL
DFEAENGENQTNGDIREAGEMESALQEKQLDSGNQELKD
CLLSAPSTPKRKRSQGKRKGVQPKKNGSNLEEVDISMAQ
AAKRRQGPTCCDMNLSGIQYDEQCDYQKMHWLYSPNLQQ
GGMRYDAI
purity :
>=90%
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-PAGE
other info1 :
Species: Arabidopsis thaliana (Mouse-ear cress)
products categories :
Epigenetics and Nuclear Signaling
products description :
Bifunctional DNA glycosylase/lyase, which excises 5-methylcytosine (5-meC) and 5-hydroxymethylcytosine (5-hmeC), leaving an apyrimidinic (AP) site that is subsequently incised by the lyase activity . Generates 3'-phosphor-alpha,beta-unsaturated aldehyde (3'-PUA) as a primary 5-meC excision intermediate. Prevents DNA hypermethylation, specifically in the promoter of otherwise silenced loci. May be involved in DNA repair through its nicking activity on methylated DNA. Binds with similar affinity to both methylated and non-methylated DNA. Highly distributive behavior on DNA substrates containing multiple 5-meC residues. Involved with Pol IV in the remodeling of the 5S rDNA chromatin via DNA methylation modifications during the first days of development post-germination. Participates in UV-B induced- and oxidative DNA damage repair .
ncbi gi num :
42569673
ncbi acc num :
NP_181190.3
ncbi gb acc num :
NM_129207.4
uniprot acc num :
Q9SJQ6
ncbi mol weight :
5kD
ncbi summary :
A repressor of transcriptional gene silencing. Functions by demethylating the target promoter DNA. Interacts physically with RPA2/ROR1. In the ros1 mutants, an increase in methylation is observed in a number of gene promoters. Among the loci affected by ros1, a few (RD29A and At1g76930) are affected in cytosine methylation in all sequence contexts (CpG, CpNpG or CpNpN), although many others are affected primarily in non-CpG contexts.
uniprot summary :
Bifunctional DNA glycosylase/lyase, which excises 5-methylcytosine (5-meC) and 5-hydroxymethylcytosine (5-hmeC), leaving an apyrimidinic (AP) site that is subsequently incised by the lyase activity (PubMed:25240767). Generates 3'-phosphor-alpha,beta-unsaturated aldehyde (3'-PUA) as a primary 5-meC excision intermediate (PubMed:25228464). Prevents DNA hypermethylation, specifically in the promoter of otherwise silenced loci. May be involved in DNA repair through its nicking activity on methylated DNA. Binds with similar affinity to both methylated and non-methylated DNA. Highly distributive behavior on DNA substrates containing multiple 5-meC residues. Involved with Pol IV in the remodeling of the 5S rDNA chromatin via DNA methylation modifications during the first days of development post-germination. Participates in UV-B induced- and oxidative DNA damage repair (PubMed:24155752).
size1 :
0.01 mg (E-Coli)
price1 :
235 USD
size2 :
0.05 mg (E-Coli)
price2 :
320
size3 :
0.1 mg (E-Coli)
price3 :
535
size4 :
0.2 mg (E-Coli)
price4 :
855
size5 :
0.5 mg (E-Coli)
price5 :
1125
size6 :
1 mg (E-Coli)
price6 :
1725
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!