catalog number :
MBS1285940
products type :
Recombinant Protein
products full name :
Recombinant Arabidopsis thaliana Protein ROS1 (ROS1), partial
products short name :
[Protein ROS1 (ROS1), partial]
products name syn :
[Protein ROS1; EC=3.2.2.-; DEMETER-like protein 1; Repressor of silencing 1]
other names :
[protein ROS1; Protein ROS1; protein ROS1; DEMETER-like protein 1; Repressor of silencing 1]
products gene name :
[ROS1]
products gene name syn :
[ROS1; DML1; At2g36490; F1O11.12]
other gene names :
[DML1; ROS1; demeter-like 1; DML1; F1O11.12; F1O11_12; REPRESSOR OF SILENCING1; ROS1; DML1]
uniprot entry name :
ROS1_ARATH
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-320aa; Partial]
sequence :
MEKQRREESSFQQPPWIPQTPMKPFSPICPYTVEDQYHS
SQLEERRFVGNKDMSGLDHLSFGDLLALANTASLIFSGQ
TPIPTRNTEVMQKGTEEVESLSSVSNNVAEQILKTPEKP
KRKKHRPKVRREAKPKREPKPRAPRKSVVTDGQESKTPK
RKYVRKKVEVSKDQDATPVESSAAVETSTRPKRLCRRVL
DFEAENGENQTNGDIREAGEMESALQEKQLDSGNQELKD
CLLSAPSTPKRKRSQGKRKGVQPKKNGSNLEEVDISMAQ
AAKRRQGPTCCDMNLSGIQYDEQCDYQKMHWLYSPNLQQ
GGMRYDAI
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-PAGE
other info1 :
Species: Arabidopsis thaliana (Mouse-ear cress)
products categories :
Epigenetics and Nuclear Signaling
products description :
Bifunctional DNA glycosylase/lyase, which excises 5-methylcytosine (5-meC) and 5-hydroxymethylcytosine (5-hmeC), leaving an apyrimidinic (AP) site that is subsequently incised by the lyase activity . Generates 3'-phosphor-alpha,beta-unsaturated aldehyde (3'-PUA) as a primary 5-meC excision intermediate. Prevents DNA hypermethylation, specifically in the promoter of otherwise silenced loci. May be involved in DNA repair through its nicking activity on methylated DNA. Binds with similar affinity to both methylated and non-methylated DNA. Highly distributive behavior on DNA substrates containing multiple 5-meC residues. Involved with Pol IV in the remodeling of the 5S rDNA chromatin via DNA methylation modifications during the first days of development post-germination. Participates in UV-B induced- and oxidative DNA damage repair .
ncbi acc num :
NP_181190.3
ncbi gb acc num :
NM_129207.4
ncbi summary :
A repressor of transcriptional gene silencing. Functions by demethylating the target promoter DNA. Interacts physically with RPA2/ROR1. In the ros1 mutants, an increase in methylation is observed in a number of gene promoters. Among the loci affected by ros1, a few (RD29A and At1g76930) are affected in cytosine methylation in all sequence contexts (CpG, CpNpG or CpNpN), although many others are affected primarily in non-CpG contexts.
uniprot summary :
Bifunctional DNA glycosylase/lyase, which excises 5-methylcytosine (5-meC) and 5-hydroxymethylcytosine (5-hmeC), leaving an apyrimidinic (AP) site that is subsequently incised by the lyase activity (PubMed:25240767). Generates 3'-phosphor-alpha,beta-unsaturated aldehyde (3'-PUA) as a primary 5-meC excision intermediate (PubMed:25228464). Prevents DNA hypermethylation, specifically in the promoter of otherwise silenced loci. May be involved in DNA repair through its nicking activity on methylated DNA. Binds with similar affinity to both methylated and non-methylated DNA. Highly distributive behavior on DNA substrates containing multiple 5-meC residues. Involved with Pol IV in the remodeling of the 5S rDNA chromatin via DNA methylation modifications during the first days of development post-germination. Participates in UV-B induced- and oxidative DNA damage repair (PubMed:24155752).