catalog number :
MBS1284126
products type :
Recombinant Protein
products full name :
Recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Diphosphoinositol polyphosphate phosphohydrolase DDP1
products short name :
Diphosphoinositol polyphosphate phosphohydrolase DDP1
products name syn :
Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase; Ap6A hydrolase; Diadenosine and diphosphoinositol polyphosphate phosphohydrolase 1; Diadenosine hexaphosphate hydrolase (AMP-forming)
other names :
polyphosphatase DDP1; Diphosphoinositol polyphosphate phosphohydrolase DDP1; polyphosphatase DDP1; Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase; Ap6A hydrolase; Diadenosine and diphosphoinositol polyphosphate phosphohydrolase 1; Diadenosine hexaphosphate hydrolase (AMP-forming) (EC:3.6.1.60)
products gene name :
DDP1
other gene names :
DDP1; DDP1; Ap6A hydrolase
uniprot entry name :
DDP1_YEAST
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-188
sequence :
GKTADNHGPVRSETAREGRENQVYSPVTGARLVAGCICL
TPDKKQVLMITSSAHKKRWIVPKGGVEKDEPNYETTAQR
ETWEEAGCIGKIVANLGTVEDMRPPKDWNKDIKQFENSR
KDSEVAKHPPRTEFHFYELEIENLLDKFPECHKRHRKLY
SYTEAKQNLIDAKRPELLEALNRSAIIKDDK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
products description :
May eliminate potentially toxic dinucleoside polyphosphates during sporulation. Most active against diadenosine 5',5'''-P1,P6-hexaphosphate (Ap6A). Can also hydrolyze diadenosine 5',5'''-P1,P5-pentaphosphate (Ap5A), adenosine 5'-pentaphosphate, and adenosine 5'-tetraphosphate are also substrates, but not diadenosine 5',5'''-P1,P4-tetraphosphate (Ap4A) or other dinucleotides, mononucleotides, nucleotide sugars, or nucleotide alcohols. Also cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate)
products references :
The diadenosine hexaphosphate hydrolases from Schizosaccharomyces pombe and Saccharomyces cerevisiae are homologues of the human diphosphoinositol polyphosphate phosphohydrolase. Overlapping substrate specificities in a MutT-type protein."
Safrany S.T., Ingram S.W., Cartwright J.L., Falck J.R., McLennan A.G., Barnes L.D., Shears S.B.
J. Biol. Chem. 274:21735-21740(1999)
ncbi acc num :
NP_014806.1
ncbi gb acc num :
NM_001183582.1
ncbi mol weight :
37.43kD
ncbi pathways :
Inositol Phosphate Biosynthesis Pathway (143472)
size5 :
0.05 mg (Baculovirus)