product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Mucosal addressin cell adhesion molecule 1
catalog :
MBS1282932
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
product information
catalog number :
MBS1282932
products type :
Recombinant Protein
products full name :
Recombinant Human Mucosal addressin cell adhesion molecule 1
products short name :
Mucosal addressin cell adhesion molecule 1
products name syn :
MAdCAM-1; hMAdCAM-1
other names :
mucosal addressin cell adhesion molecule 1 isoform a; Mucosal addressin cell adhesion molecule 1; mucosal addressin cell adhesion molecule 1; mucosal vascular addressin cell adhesion molecule 1
products gene name :
MADCAM1
other gene names :
MADCAM1; MADCAM1; MACAM1; MAdCAM-1; hMAdCAM-1
uniprot entry name :
MADCA_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
19-317; Partial. Provide the complete extracellular domain.
sequence length :
317
sequence :
QSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGAS
VQWRGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVG
SCGGRTFQHTVQLLVYAFPDQLTVSPAALVPGDPEVACT
AHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEE
PQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGL
ELSHRQAIPVLHSPTSPEPPDTTSPESPDTTSPESPDTT
SQEPPDTTSPEPPDKTSPEPAPQQGSTHTPRSPGSTRTR
RPEISQAGPTQGEVIPTGSSKPAGDQ
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products categories :
Immunology
products description :
Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.
products references :
Cloning of the mucosal addressin MAdCAM-1 from human brain: identification of novel alternatively spliced transcripts." Leung E., Greene J., Ni J., Raymond L.G., Lehnert K., Langley R., Krissansen G.W. Immunol. Cell Biol. 74:490-496(1996)
ncbi gi num :
109633022
ncbi acc num :
NP_570116.2
ncbi gb acc num :
NM_130760.2
uniprot acc num :
Q13477
ncbi mol weight :
47.39kD
ncbi pathways :
Adaptive Immune System Pathway (1269171); Cell Adhesion Molecules (CAMs) Pathway (83069); Cell Adhesion Molecules (CAMs) Pathway (480); Extracellular Matrix Organization Pathway (1270244); Immune System Pathway (1269170); Immunoregulatory Interactions Between A Lymphoid And A Non-Lymphoid Cell Pathway (1269201); Integrin Cell Surface Interactions Pathway (1270260); Intestinal Immune Network For IgA Production Pathway (128760); Intestinal Immune Network For IgA Production Pathway (128670); Paxillin-independent Events Mediated By A4b1 And A4b7 Pathway (137971)
ncbi summary :
The protein encoded by this gene is an endothelial cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4beta7), L-selectin, and VLA-4 (alpha4beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin family and is similar to ICAM1 and VCAM1. At least seven alternatively spliced transcripts encoding different protein isoforms have been found for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008]
uniprot summary :
MADCAM1: Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L- selectin binding. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Motility/polarity/chemotaxis. Chromosomal Location of Human Ortholog: 19p13.3. Cellular Component: integral to membrane; membrane; plasma membrane. Biological Process: aging; cell adhesion; cell-matrix adhesion; extracellular matrix organization and biogenesis; heterotypic cell-cell adhesion; immune response; integrin-mediated signaling pathway; keratinocyte differentiation; leukocyte tethering or rolling; positive regulation of leukocyte migration; receptor clustering; regulation of immune response; signal transduction
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.2 mg (E-Coli)
price2 :
490
size3 :
0.5 mg (E-Coli)
price3 :
715
size4 :
0.05 mg (Baculovirus)
price4 :
950
size5 :
1 mg (E-Coli)
price5 :
1170
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!