catalog number :
MBS1281588
products type :
Recombinant Protein
products full name :
Recombinant Naja kaouthia (Monocled cobra) (Naja siamensis) Cobra venom factor
products short name :
[Cobra venom factor]
products name syn :
[Complement C3 homolog]
other names :
[Cobra venom factor; Cobra venom factor; Complement C3 homolog]
other gene names :
[CVF; CVFk]
uniprot entry name :
VCO3_NAJKA
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[733-984. Partial,provide Cobra venom factor gamma chain]
sequence :
DDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGI
SSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRV
MKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVE
LLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLE
QGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTI
VKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQ
GDPVAQIIENSIDGSKLN
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-PAGE
other info2 :
Species: Naja kaouthia (Monocled cobra) (Naja siamensis). Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Complement-activating protein in cobra venom. It is a structural and functional analog of complement component C3b, the activated form of C3. It binds factor B (CFB), which is subsequently cleaved by factor D (CFD) to form the bimolecular complex CVF/Bb. CVF/Bb is a C3/C5 convertase that cleaves both complement components C3 and C5. Structurally, it resembles the C3b degradation product C3c, which is not able to form a C3/C5 convertase. Unlike C3b/Bb, CVF/Bb is a stable complex and completely resistant to the actions of complement regulatory factors H (CFH) and I (CFI). Therefore, CVF continuously activates complement resulting in the depletion of complement activity.
products references :
Molecular cloning and derived primary structure of cobra venom factor."
Fritzinger D.C., Bredehorst R., Vogel C.-W.
Proc. Natl. Acad. Sci. U.S.A. 91:12775-12779(1994)
ncbi mol weight :
55.07kD
uniprot summary :
Complement-activating protein in cobra venom. It is a structural and functional analog of complement component C3b, the activated form of C3. It binds factor B (CFB), which is subsequently cleaved by factor D (CFD) to form the bimolecular complex CVF/Bb. CVF/Bb is a C3/C5 convertase that cleaves both complement components C3 and C5. Structurally, it resembles the C3b degradation product C3c, which is not able to form a C3/C5 convertase. Unlike C3b/Bb, CVF/Bb is a stable complex and completely resistant to the actions of complement regulatory factors H (CFH) and I (CFI). Therefore, CVF continuously activates complement resulting in the depletion of complement activity.
size6 :
0.05 mg (Baculovirus)
size10 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size14 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)