product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human Fibroblast growth factor 7
catalog :
MBS1265600
quantity :
0.5 mg (E-Coli)
price :
905 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1265600
products type :
Recombinant Protein
products full name :
Recombinant human Fibroblast growth factor 7
products short name :
Fibroblast growth factor 7
other names :
fibroblast growth factor 7; Fibroblast growth factor 7; fibroblast growth factor 7; FGF-7; keratinocyte growth factor; heparin-binding growth factor 7; fibroblast growth factor 7; Heparin-binding growth factor 7; HBGF-7; Keratinocyte growth factor
other gene names :
FGF7; FGF7; KGF; HBGF-7; KGF; FGF-7; HBGF-7
uniprot entry name :
FGF7_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence :
DMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCR
TQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIK
GVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNT
YASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFL
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
ncbi gi num :
4503705
ncbi acc num :
NP_002000.1
ncbi gb acc num :
NM_002009.3
uniprot acc num :
P21781
ncbi mol weight :
22,509 Da
ncbi pathways :
Activated Point Mutants Of FGFR2 Pathway (645281); Adaptive Immune System Pathway (366160); Constitutive PI3K/AKT Signaling In Cancer Pathway (685535); DAP12 Interactions Pathway (685549); DAP12 Signaling Pathway (685550); Disease Pathway (530764); Downstream Signaling Events Of B Cell Receptor (BCR) Pathway (576250); Downstream Signal Transduction Pathway (106385); Downstream Signaling Of Activated FGFR Pathway (160957); FGFR Ligand Binding And Activation Pathway (106344)
ncbi summary :
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis. [provided by RefSeq, Jul 2008]
uniprot summary :
FGF7: Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation. Belongs to the heparin-binding growth factors family. Protein type: Secreted; Secreted, signal peptide; Cytokine. Chromosomal Location of Human Ortholog: 15q21.2. Cellular Component: Golgi apparatus; extracellular region. Molecular Function: heparin binding; protein binding; growth factor activity; chemoattractant activity; fibroblast growth factor receptor binding. Biological Process: epidermal growth factor receptor signaling pathway; positive regulation of keratinocyte migration; epidermis development; hair follicle morphogenesis; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; mesenchymal cell proliferation; signal transduction; positive regulation of peptidyl-tyrosine phosphorylation; positive chemotaxis; positive regulation of cell division; actin cytoskeleton reorganization; positive regulation of cell proliferation; response to wounding; insulin receptor signaling pathway; innate immune response; positive regulation of epithelial cell proliferation
size1 :
0.5 mg (E-Coli)
price1 :
905 USD
size2 :
0.05 mg (Baculovirus)
price2 :
905
size3 :
0.5 mg (Yeast)
price3 :
1130
size4 :
0.05 mg (Mammalian-Cell)
price4 :
1130
size5 :
1 mg (E-Coli)
price5 :
1340
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!