catalog number :
MBS1265578
products type :
Recombinant Protein
products full name :
Recombinant Human Receptor tyrosine-protein kinase erbB-2
products short name :
Receptor tyrosine-protein kinase erbB-2
products name syn :
Metastatic lymph node gene 19 protein; MLN 19; Proto-oncogene Neu; Proto-oncogene c-ErbB-2; Tyrosine kinase-type cell surface receptor HER2; p185erbB2; CD340
other names :
receptor tyrosine-protein kinase erbB-2 isoform b; Receptor tyrosine-protein kinase erbB-2; erb-b2 receptor tyrosine kinase 2; Metastatic lymph node gene 19 protein; MLN 19; Proto-oncogene Neu; Proto-oncogene c-ErbB-2; Tyrosine kinase-type cell surface receptor HER2; p185erbB2; CD_antigen: CD340
products gene name :
ERBB2
products gene name syn :
HER2; MLN19; NEU; NGL
other gene names :
ERBB2; ERBB2; NEU; NGL; HER2; TKR1; CD340; HER-2; MLN 19; HER-2/neu; HER2; MLN19; NEU; NGL; MLN 19
uniprot entry name :
ERBB2_HUMAN
sequence positions :
153-598
sequence :
VLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRA
CHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGP
LPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCP
ALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDV
GSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGM
EHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPA
SNTAPLQPEQLQVFETLEEIT
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Transcription
products description :
Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane. In turn, membrane-bound APC allows the localization of MACF1 to the cell membrane, which is required for microtubule capture and stabilization. In the nucleus is involved in transcriptional regulation. Associates with the 5'-TCAAATTC-3' sequence in the PTGS2/COX-2 promoter and activates its transcription. Implicated in transcriptional activation of CDKN1A; the function involves STAT3 and SRC. Involved in the transcription of rRNA genes by RNA Pol I and enhances protein synthesis and cell growth.
products references :
Similarity of protein encoded by the human c-erb-B-2 gene to epidermal growth factor receptor.Yamamoto T., Ikawa S., Akiyama T., Semba K., Nomura N., Miyajima N., Saito T., Toyoshima K.Nature 319:230-234(1986)
Tyrosine kinase receptor with extensive homology to EGF receptor shares chromosomal location with neu oncogene.Coussens L., Yang-Feng T.L., Liao Y.C., Chen E., Gray A., McGrath J., Seeburg P.H., Libermann T.A., Schlessinger J., Francke U., Levinson A., Ullrich A.Science 230:1132-1139(1985)
NIEHS SNPs programNEDO human cDNA sequencing project focused on splicing variants.Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A., Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y., Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T., Sugano S., Nomura N., Isogai T.
ncbi acc num :
NP_001005862.1
ncbi gb acc num :
NM_001005862.2
ncbi pathways :
ARMS-mediated Activation Pathway (1269471); Adaptive Immune System Pathway (1269171); Adherens Junction Pathway (83070); Adherens Junction Pathway (481); Alpha6-Beta4 Integrin Signaling Pathway (198807); Axon Guidance Pathway (1270303); Bladder Cancer Pathway (83115); Bladder Cancer Pathway (527); Calcium Signaling Pathway (83050); Calcium Signaling Pathway (459)
ncbi summary :
This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized. [provided by RefSeq, Jul 2008]
uniprot summary :
HER2: a proto-oncogenic receptor tyrosine kinase of the EGFR family. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. Not activated by EGF, TGF- alpha and amphiregulin. Amplified in breast cancer. Overexpression induces constitutive activity, and the gene is amplified or overexpressed in up to 30% of breast cancers, correlating with poor survival. The antibody Herceptin is approved for treatment of metastatic breast cancer with HER2 amplification/overexpression. Somatic mutations seen in 4% of lung cancers and also in breast, gastric, ovarian cancer and glioblastoma. One SNP shows predisposition to breast and gastric cancer. Inhibitors: Herceptin, lapatinib, PKI-166, EKB-569, CI-1033. Protein type: Protein kinase, TK; Oncoprotein; Membrane protein, integral; Protein kinase, tyrosine (receptor); Kinase, protein; EC 2.7.10.1; TK group; EGFR family. Chromosomal Location of Human Ortholog: 17q12. Cellular Component: apical plasma membrane; basolateral plasma membrane; cytoplasm; cytoplasmic vesicle; endosome membrane; integral to membrane; myelin sheath; nucleus; perinuclear region of cytoplasm; plasma membrane; receptor complex. Molecular Function: ATP binding; ErbB-3 class receptor binding; growth factor binding; identical protein binding; protein binding; protein C-terminus binding; protein dimerization activity; protein heterodimerization activity; protein phosphatase binding; protein-tyrosine kinase activity; receptor signaling protein tyrosine kinase activity; transmembrane receptor activity; transmembrane receptor protein tyrosine kinase activity. Biological Process: activation of MAPKK activity; axon guidance; cell proliferation; cell surface receptor linked signal transduction; enzyme linked receptor protein signaling pathway; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; heart development; innate immune response; insulin receptor signaling pathway; MAPKKK cascade; motor axon guidance; myelination; negative regulation of immature T cell proliferation in the thymus; nerve growth factor receptor signaling pathway; neuromuscular junction development; oligodendrocyte differentiation; peptidyl-tyrosine phosphorylation; peripheral nervous system development; phosphoinositide 3-kinase cascade; phosphoinositide-mediated signaling; positive regulation of cell adhesion; positive regulation of cell growth; positive regulation of epithelial cell proliferation; positive regulation of GTPase activity; positive regulation of MAP kinase activity; positive regulation of protein amino acid phosphorylation; positive regulation of transcription from RNA polymerase I promoter; positive regulation of transcription from RNA polymerase III promoter; positive regulation of translation; protein amino acid autophosphorylation; protein amino acid phosphorylation; Ras protein signal transduction; regulation of angiogenesis; regulation of microtubule-based process; signal transduction; small GTPase mediated signal transduction; transcription, DNA-dependent; transmembrane receptor protein tyrosine kinase signaling pathway; vascular endothelial growth factor receptor signaling pathway; wound healing. Disease: Gastric Cancer; Glioma Susceptibility 1; Lung Cancer