Recombinant Human TAR DNA-binding protein 43 | MyBioSource MBS1265560 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human TAR DNA-binding protein 43

catalog :

MBS1265560

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1265560

products type :

Recombinant Protein

products full name :

Recombinant Human TAR DNA-binding protein 43

products short name :

TAR DNA-binding protein 43

other names :

TAR DNA-binding protein 43; TAR DNA-binding protein 43; TAR DNA-binding protein 43; TAR DNA binding protein

products gene name :

TARDBP

other gene names :

TARDBP; TARDBP; ALS10; TDP-43; TDP43; TDP-43

uniprot entry name :

TADBP_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-396

sequence length :

414

sequence :

MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGAC
GLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYP
KDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTE
QDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE
TQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFV
GRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTF
ADDQIAQSLCGEDLIIKGISV

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Transcription

products description :

DNA and RNA-binding protein which regulates transcription and splicing. Involved in the regulation of CFTR splicing. It promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. May also be involved in microRNA biogenesis, apoptosis and cell division. Can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat. Stabilizes the low molecular weight neurofilament (NFL) mRNA through a direct interaction with the 3' UTR.

products references :

Cloning and characterization of a novel cellular protein, TDP-43, that binds to human immunodeficiency virus type 1 TAR DNA sequence motifs.Ou S.-H.I., Wu F., Harrich D., Garcia-Martinez L.F., Gaynor R.B.J. Virol. 69:3584-3596(1995) TDP43 is a human low molecular weight neurofilament (hNFL) mRNA-binding protein.Strong M.J., Volkening K., Hammond R., Yang W., Strong W., Leystra-Lantz C., Shoesmith C.Mol. Cell. Neurosci. 35:320-327(2007) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

ncbi gi num :

6678271

ncbi acc num :

NP_031401.1

ncbi gb acc num :

NM_007375.3

uniprot acc num :

Q13148

ncbi mol weight :

58.89kD

ncbi summary :

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq, Jul 2008]

uniprot summary :

TARDBP: DNA and RNA-binding protein which regulates transcription and splicing. Involved in the regulation of CFTR splicing. It promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. May also be involved in microRNA biogenesis, apoptosis and cell division. Can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat. Stabilizes the low molecular weight neurofilament (NFL) mRNA through a direct interaction with the 3' UTR. Homodimer. Binds specifically to pyrimidine-rich motifs of TAR DNA and to single stranded TG repeated sequences. Binds to RNA, specifically to UG repeated sequences with a minimun of six contiguous repeats. Interacts with ATNX2; the interaction is RNA-dependent. Ubiquitously expressed. In particular, expression is high in pancreas, placenta, lung, genital tract and spleen. 3 isoforms of the human protein are produced by alternative splicing. Protein type: RNA-binding. Chromosomal Location of Human Ortholog: 1p36.22. Cellular Component: cytoplasm; nuclear speck; nucleoplasm; nucleus; perichromatin fibrils. Molecular Function: double-stranded DNA binding; identical protein binding; mRNA 3'-UTR binding; nucleotide binding; protein binding; RNA binding; transcription factor activity. Biological Process: mRNA processing; negative regulation of protein amino acid phosphorylation; nuclear fragmentation during apoptosis; positive regulation of insulin secretion; positive regulation of transcription from RNA polymerase II promoter; regulation of cell cycle; RNA splicing; transcription from RNA polymerase II promoter. Disease: Amyotrophic Lateral Sclerosis 10, With Or Without Frontotemporal Dementia

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

260

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

600

size5 :

0.5 mg (E-Coli)

price5 :

750

more info or order :

MyBioSource product webpage