Recombinant Rat Haptoglobin protein | MyBioSource MBS1265546 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Rat Haptoglobin protein

catalog :

MBS1265546

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1265546

products type :

Recombinant Protein

products full name :

Recombinant Rat Haptoglobin protein

products short name :

Haptoglobin protein

products name syn :

Liver regeneration-related protein LRRG173; Zonulin

other names :

haptoglobin; Haptoglobin; haptoglobin; haptoglobin; Liver regeneration-related protein LRRG173; Zonulin

products gene name :

other gene names :

Hp; Hp; Ba1-647

uniprot entry name :

HPT_RAT

host :

E Coli

sequence positions :

19-346

sequence length :

347

sequence :

VELGNDATDIEDDSCPKPPEIANGYVEHLVRYRCRQFYK
LQTEGDGIYTLNSEKQWVNPAAGDKLPKCEAVCGKPKHP
VDQVQRIIGGSMDAKGSFPWQAKMISRHGLTTGATLISD
QWLLTTAQNLFLNHSENATAKDIAPTLTLYVGKNQLVEI
EKVVLHPERSVVDIGLIKLKQKVLVTEKVMPICLPSKDY
VAPGRMGYVSGWGRNVNFRFTERLKYVMLPVADQEKCEL
HYEKSTVPEKKGAVSPVGVQP

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Epigenetics and Nuclear Signaling

products description :

As a result of holysis, hoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hoglobin to allow hepatic recycling of he iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway. Uncleaved haptoglogin, also known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassembly, and controlling the equilibrium between tolerance and immunity to non-self antigens.

products references :

Structure, hormonal regulation, and identification of the interleukin-6- and dexamethasone-responsive element of the rat haptoglobin gene.Marinkovic S., Baumann H.Mol. Cell. Biol. 10:1573-1583(1990) Liver regeneration after PH.Xu C.S., Li W.Q., Li Y.C., Ma H., Wang L., Wang S.F., Han H.P., Wang G.P., Chai L.Q., Yuan J.Y., Yang K.J., Yan H.M., Chang C.F., Zhao L.F., Shi J.B., Rahman S., Wang Q.N., Zhang J.B. Nucleotide sequence of rat haptoglobin cDNA. Characterization of the alpha beta-subunit junction region of prohaptoglobin.Goldstein L.A., Heath E.C.J. Biol. Chem. 259:9212-9217(1984) Biosynthesis and processing of rat haptoglobin.Hanley J.M., Haugen T.H., Heath E.C.J. Biol. Chem. 258:7858-7869(1983) Comparative sequence analysis of the N-terminal region of rat, rabbit, and dog haptoglobin beta-chains.Kurosky A., Kim H.H., Touchstone B.Comp. Biochem. Physiol. 55B:453-459(1976) Lubec G., Afjehi-Sadat L.Submitted (DEC-2006) to UniProtKB

ncbi gi num :

60097941

ncbi acc num :

NP_036714.2

ncbi gb acc num :

NM_012582.2

uniprot acc num :

P06866

ncbi mol weight :

40.6kD

ncbi pathways :

Binding And Uptake Of Ligands By Scavenger Receptors Pathway (1333660); Scavenging Of Heme From Plasma Pathway (1333661); Vesicle-mediated Transport Pathway (1333636)

ncbi summary :

may bind hemoglobin and mediate hemoglobin catabolism in lung cells; may play a role in inflammatory response [RGD, Feb 2006]

uniprot summary :

HP: Haptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes. Defects in HP are the cause of anhaptoglobinemia (AHP). AHP is a condition characterized by the absence of the serum glycoprotein haptoglobin. Serum levels of haptoglobin vary among normal persons: levels are low in the neonatal period and in the elderly, differ by population, and can be influenced by environmental factors, such as infection. Secondary hypohaptoglobinemia can occur as a consequence of hemolysis, during which haptoglobin binds to free hemoglobin. Belongs to the peptidase S1 family. Protein type: Enzyme, misc.; Protease; Endoplasmic reticulum; Secreted, signal peptide; Secreted. Cellular Component: endoplasmic reticulum; extracellular region; extracellular space; Golgi apparatus. Molecular Function: antioxidant activity; hemoglobin binding; protein homodimerization activity; serine-type endopeptidase activity. Biological Process: acute inflammatory response; acute-phase response; defense response to bacterium; immune system process; liver development; negative regulation of oxidoreductase activity; Notch signaling pathway; organ regeneration; proteolysis; response to cobalamin; response to drug; response to electrical stimulus; response to glucocorticoid stimulus; response to heat; response to hydrogen peroxide; response to hypoxia; response to L-ascorbic acid; response to lead ion; response to lipopolysaccharide; response to magnesium ion; response to organic cyclic substance; response to organic substance; response to X-ray; spermatogenesis

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

more info or order :

MyBioSource product webpage