Recombinant Human Vitamin D-binding protein | MyBioSource MBS1265529 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Vitamin D-binding protein

catalog :

MBS1265529

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1265529

products type :

Recombinant Protein

products full name :

Recombinant Human Vitamin D-binding protein

products short name :

Vitamin D-binding protein

products name syn :

c-Fos-induced growth factor; FIGF

other names :

vascular endothelial growth factor D preproprotein; Vascular endothelial growth factor D; vascular endothelial growth factor D; c-fos induced growth factor (vascular endothelial growth factor D); c-Fos-induced growth factor; FIGF

products gene name :

VDBP

products gene name syn :

GC; DBP; DBP; GC; GRD3; VDBG

other gene names :

FIGF; FIGF; VEGFD; VEGF-D; VEGFD; VEGF-D; FIGF

uniprot entry name :

VEGFD_HUMAN

host :

E Coli

sequence positions :

19-474

sequence length :

354

sequence :

RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTF
EQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSC
ESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPT
YVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSL
LVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLT
TLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVL
PLAEDITNILSKCCESASEDC

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cancer

products description :

Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.

products references :

Molecular cloning of a novel vascular endothelial growth factor, VEGF-D.Yamada Y., Nezu J., Shimane M., Hirata Y.Genomics 42:483-488(1997) Human FIGF cloning, gene structure, and mapping to chromosome Xp22.1 between the PIGA and the GRPR genes.Rocchigiani M., Lestingi M., Luddi A., Orlandini M., Franco B., Rossi E., Ballabio A., Zuffardi O., Oliviero S.Genomics 47:207-216(1998) Vascular endothelial growth factor D (VEGF-D) is a ligand for the tyrosine kinases VEGF receptor 2 (Flk1) and VEGF receptor 3 (Flt4) .Achen M.G., Jeltsch M., Kukk E., Maekinen T., Vitali A., Wilks A.F., Alitalo K., Stacker S.A.Proc. Natl. Acad. Sci. U.S.A. 95:548-553(1998) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

ncbi gi num :

4758378

ncbi acc num :

NP_004460.1

ncbi gb acc num :

NM_004469.4

uniprot acc num :

O43915

ncbi mol weight :

55kD

ncbi pathways :

AGE-RAGE Signaling Pathway In Diabetic Complications (1319988); AGE-RAGE Signaling Pathway In Diabetic Complications (1319775); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Focal Adhesion Pathway (198795); Focal Adhesion Pathway (83067); Focal Adhesion Pathway (478); Hemostasis Pathway (1269340); PI3K-Akt Signaling Pathway (692234); PI3K-Akt Signaling Pathway (692979)

ncbi summary :

The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-2 and VEGFR-3 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor C. Read-through transcription has been observed between this locus and the upstream PIR (GeneID 8544) locus. [provided by RefSeq, Feb 2011]

uniprot summary :

VEGFD: Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. Belongs to the PDGF/VEGF growth factor family. Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted; Cytokine. Chromosomal Location of Human Ortholog: Xp22.31. Cellular Component: extracellular region; extracellular space; membrane. Molecular Function: chemoattractant activity; growth factor activity; platelet-derived growth factor receptor binding; protein homodimerization activity; vascular endothelial growth factor receptor 3 binding; vascular endothelial growth factor receptor binding. Biological Process: angiogenesis; blood coagulation; cell differentiation; cell proliferation; induction of positive chemotaxis; platelet activation; platelet degranulation; positive chemotaxis; positive regulation of cell division; positive regulation of cell proliferation; positive regulation of interleukin-6 production; regulation of vascular endothelial growth factor receptor signaling pathway; response to hypoxia; vascular endothelial growth factor receptor signaling pathway

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

more info or order :

MyBioSource product webpage