VNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLG
YGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSA
SIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVD
QVTGISRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPI
TVKFANNPSQKTNQAILSQLYQSPNRRYPGPLAQQAQRF
RLDNLLNMAYGVKRFSPMTID

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Rat Haptoglobin protein | MBS1265546
- Recombinant Human Seprase | MBS1265618
- Recombinant Salmonella typhimurium Secreted effector protein sopD2 (sopD2)
- Recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast ...
- Recombinant Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii) C-1-tetrah ...