Recombinant Human ELAV-like protein 2 | MyBioSource MBS1265522 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human ELAV-like protein 2

catalog :

MBS1265522

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1265522

products type :

Recombinant Protein

products full name :

Recombinant Human ELAV-like protein 2

products short name :

ELAV-like protein 2

products name syn :

ELAV-like neuronal protein 1; Hu-antigen B; HuB; Nervous system-specific RNA-binding protein Hel-N1

other names :

ELAV-like protein 2 isoform b; ELAV-like protein 2; ELAV-like protein 2; ELAV like neuron-specific RNA binding protein 2; ELAV-like neuronal protein 1; Hu-antigen B; HuB; Nervous system-specific RNA-binding protein Hel-N1

products gene name :

ELAVL2

other gene names :

ELAVL2; ELAVL2; HUB; HELN1; HEL-N1; HUB; HuB

uniprot entry name :

ELAV2_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

4-356

sequence length :

346

sequence :

QLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNLI
VNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLG
YGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSA
SIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVD
QVTGISRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPI
TVKFANNPSQKTNQAILSQLYQSPNRRYPGPLAQQAQRF
RLDNLLNMAYGVKRFSPMTID

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Epigenetics and Nuclear Signaling

products description :

Binds RNA. Ses to recognize a GAAA motif. Can bind to its own 3'-UTR, the FOS 3'-UTR and the ID 3'-UTR.

products references :

Mammalian homologs of Drosophila ELAV localized to a neuronal subset can bind in vitro to the 3' UTR of mRNA encoding the Id transcriptional repressor.King P.H., Levine T.D., Fremeau R.T. Jr., Keene J.D.J. Neurosci. 14:1943-1952(1994) Selection of a subset of mRNAs from combinatorial 3' untranslated region libraries using neuronal RNA-binding protein Hel-N1.Gao F.B., Carson C.C., Levine T., Keene J.D.Proc. Natl. Acad. Sci. U.S.A. 91:11207-11211(1994) Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)

ncbi gi num :

283945529

ncbi acc num :

NP_001164666.1

ncbi gb acc num :

NM_001171195.1

uniprot acc num :

Q12926

ncbi mol weight :

42.9kD

ncbi summary :

The protein encoded by this gene is a neural-specific RNA-binding protein that is known to bind to several 3' UTRs, including its own and also that of FOS and ID. The encoded protein may recognize a GAAA motif in the RNA. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]

uniprot summary :

ELAVL2: Binds RNA. Seems to recognize a GAAA motif. Can bind to its own 3'-UTR, the FOS 3'-UTR and the ID 3'-UTR. Belongs to the RRM elav family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: RNA-binding. Chromosomal Location of Human Ortholog: 9p21. Molecular Function: mRNA 3'-UTR binding; nucleotide binding; protein binding. Biological Process: regulation of transcription, DNA-dependent

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (E-Coli)

price5 :

750

more info or order :

MyBioSource product webpage