product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Ba(E Coli -k12) Flagellin protein
catalog :
MBS1265520
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1265520
products type :
Recombinant Protein
products full name :
Recombinant Ba(E Coli -k12) Flagellin protein
products short name :
Ba(E Coli -k12) Flagellin protein
other names :
flagellar filament structural protein (flagellin); Flagellin; flagellar filament structural protein (flagellin)
other gene names :
fliC; fliC; ECK1922; flaF; H; hag; JW1908; flaF; hag
uniprot entry name :
FLIC_ECOLI
host :
E Coli
sequence positions :
2-498
sequence length :
498
sequence :
AQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINS
AKDDAAGQAIANRFTSNIKGLTQAARNANDGISVAQTTE
GALSEINNNLQRVRELTVQATTGTNSESDLSSIQDEIKS
RLDEIDRVSGQTQFNGVNVLAKNGSMKIQVGANDNQTIT
IDLKQIDAKTLGLDGFSVKNNDTVTTSAPVTAFGATTTN
NIKLTGITLSTEAATDTGGTNPASIEGVYTDNGNDYYAK
ITGGDNDGKYYAVTVANDGTV
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Flagellin is the subunit protein which polymerizes to form the filaments of bacterial flagella.
products references :
Nucleotide sequence of the hag gene encoding flagellin of Escherichia coli.Kuwajima G., Asaka J., Fujiwara T., Fujiwara T., Node K., Kondo E.J. Bacteriol. 168:1479-1483(1986) Isolation and characterization of Escherichia coli hag operator mutants whose hag48 expression has become repressible by a Salmonella H1 repressor.Hanafusa T., Sakai A., Tominaga A., Enomoto M.Mol. Gen. Genet. 216:44-50(1989) A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map.Itoh T., Aiba H., Baba T., Fujita K., Hayashi K., Inada T., Isono K., Kasai H., Kimura S., Kitakawa M., Kitagawa M., Makino K., Miki T., Mizobuchi K., Mori H., Mori T., Motomura K., Nakade S., Nakamura Y., Nashimoto H., Nishio Y., Oshima T., Saito N., Sampei G., Seki Y., Sivasundaram S., Tagami H., Takeda J., Takemoto K., Wada C., Yamamoto Y., Horiuchi T.DNA Res. 3:379-392(1996) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) DNA sequence adjacent to flagellar genes and evolution of flagellar-phase variation.Szekely E., Simon M.J. Bacteriol. 155:74-81(1983) Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12.Link A.J., Robison K., Church G.M.Electrophoresis 18:1259-1313(1997) Protein identification with N and C-terminal sequence tags in proteome projects.Wilkins M.R., Gasteiger E., Tonella L., Ou K., Tyler M., Sanchez J.-C., Gooley A.A., Walsh B.J., Bairoch A., Appel R.D., Williams K.L., Hochstrasser D.F.J. Mol. Biol. 278:599-608(1998)
ncbi gi num :
16129870
ncbi acc num :
NP_416433.1
ncbi gb acc num :
NC_000913.3
uniprot acc num :
P04949
ncbi mol weight :
78.5kD
ncbi pathways :
Disease Pathway (1268854); Diseases Associated With The TLR Signaling Cascade Pathway (1269157); Diseases Of Immune System Pathway (1269156); Flagellar Assembly Pathway (1118); Flagellar Assembly Pathway (439); IRAK4 Deficiency (TLR5) Pathway (1269159); Immune System Pathway (1269170); Innate Immune System Pathway (1269203); MyD88 Cascade Initiated On Plasma Membrane Pathway (1269207); MyD88 Deficiency (TLR5) Pathway (1269161)
ncbi summary :
Flagellar regulon. [More information is available at EcoGene: EG10321]. FliC, or flagellin, is the basic subunit that polymerizes to form the rigid flagellar filament of Escherichia coli. [More information is available at EcoCyc: EG10321].
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.2 mg (E-Coli)
price2 :
410
size3 :
0.5 mg (E-Coli)
price3 :
665
size4 :
1 mg (E-Coli)
price4 :
1050
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!