catalog number :
MBS1265516
products type :
Recombinant Protein
products full name :
Recombinant Mouse Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1
products short name :
Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1
products name syn :
Leucine-rich repeat neuronal protein 1; Leucine-rich repeat neuronal protein 6A
other names :
leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 isoform 1; Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1; leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1; leucine rich repeat and Ig domain containing 1; Leucine-rich repeat neuronal protein 1; Leucine-rich repeat neuronal protein 6A
products gene name :
Lingo1
products gene name syn :
Lern1; Lrrn6a
other gene names :
Lingo1; Lingo1; LERN1; Lrrn6a; UNQ201; LINGO-1; AV148400; 4930471K13Rik; Lern1; Lrrn6a
uniprot entry name :
LIGO1_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
37-555,Partial,Provide the complete extracellular domain.
sequence :
CPPRCECSAQDRAVLCHRKRFVAVPEGIPTETRLLDLGK
NRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLF
NLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVIL
LDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLT
LEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFK
RLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNL
TAVPYLAVRHLVYLRFLNLSYNPIGTIEGSMLHELLRLQ
EIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEES
AFHSVGNLETLILDSNPLACDCRLLWVFRRRWRLNFNRQ
QPTCATPEFVQGKEFKDFPDVLLPNYFTCRRAHIRDRKA
QQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKS
NGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAGGNDSMP
AHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRATV
PFPFDIKTLIIAT
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Functional component of the Nogo receptor signaling complex (RTN4R/NGFR) in RhoA activation responsible for some inhibition of axonal regeneration by myelin-associated factors. Is also an important negative regulator of oligodentrocyte differentiation and axonal myelination. Acts in conjunction with RTN4 and RTN4R in regulating neuronal precursor cell motility during cortical development. 1 Publication
ncbi acc num :
NP_001298005.1
ncbi gb acc num :
NM_001311076.1
ncbi pathways :
Axonal Growth Inhibition (RHOA Activation) Pathway (1324627); Signal Transduction Pathway (1324550); Signalling By NGF Pathway (1324614); MRNA Processing Pathway (198369); P75 NTR Receptor-mediated Signalling Pathway (1324616); P75NTR Regulates Axonogenesis Pathway (1324625)
uniprot summary :
LINGO1: Functional component of the Nogo receptor signaling complex (RTN4R/NGFR) in RhoA activation responsible for some inhibition of axonal regeneration by myelin-associated factors. Is also an important negative regulator of oligodentrocyte differentiation and axonal myelination. Acts in conjunction with RTN4 and RTN4R in regulating neuronal precursor cell motility during cortical development. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral. Cellular Component: integral to membrane; membrane; plasma membrane. Molecular Function: epidermal growth factor receptor binding; protein binding. Biological Process: axonogenesis; central nervous system neuron development; negative regulation of oligodendrocyte differentiation; neurite development; protein kinase B signaling cascade