Recombinant Human Mucin-1 (MUC1), partial | MyBioSource MBS1265502 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Mucin-1 (MUC1), partial

catalog :

MBS1265502

quantity :

0.05 mg (E-Coli)

price :

180 USD

product information

catalog number :

MBS1265502

products type :

Recombinant Protein

products full name :

Recombinant Human Mucin-1 (MUC1), partial

products short name :

Mucin-1 (MUC1), partial

products name syn :

Mucin-1; MUC-1; Breast carcinoma-associated antigen DF3; Carcinoma-associated mucin; Episialin; H23AG; Krebs von den Lungen-6; KL-6; PEMT; Peanut-reactive urinary mucin; PUM; Polymorphic epithelial mucin; PEM; Tumor-associated epithelial membrane antigen;

other names :

mucin-1 isoform 10; Mucin-1; mucin-1; episialin; DF3 antigen; H23 antigen; cancer antigen 15-3; krebs von den Lungen-6; mucin 1, transmembrane; tumor-associated mucin; carcinoma-associated mucin; polymorphic epithelial mucin; peanut-reactive urinary mucin; tumor associated epithelial mucin; breast carcinoma-associated antigen DF3; tumor-associated epithelial membrane antigen; mucin 1, cell surface associated; Breast carcinoma-associated antigen DF3; Cancer antigen 15-3; CA 15-3; Carcinoma-associated mucin; Episialin; H23AG; Krebs von den Lungen-6; KL-6; PEMT; Peanut-reactive urinary mucin; PUM; Polymorphic epithelial mucin; PEM; Tumor-associated epithelial membrane antigen; EMA; Tumor-associated mucin; CD_antigen: CD227Cleaved into the following 2 chains:Mucin-1 subunit alpha; MUC1-NT; MUC1-alpha; Mucin-1 subunit beta; MUC1-betaAlternative name(s):MUC1-CT

products gene name :

MUC1

products gene name syn :

MUC1; PUM

other gene names :

MUC1; MUC1; EMA; PEM; PUM; KL-6; MAM6; PEMT; CD227; H23AG; MCKD1; MUC-1; CA 15-3; MUC-1/X; MUC1/ZD; MUC-1/SEC; PUM; MUC-1; CA 15-3; KL-6; PUM; PEM; EMA; MUC1-NT; MUC1-alpha; MUC1-beta

uniprot entry name :

MUC1_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

24-273; Provide the mature full length of Isoform 8 (identifier: P15941-8).

sequence length :

273

sequence :

LQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY NLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIF PARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL
SGHASSTPGGEKETSATQRSSVPSSTEKNALSTGVSFFF
LSFHISNLQFNSSLEDPSTDYYQE

purity :

>90%

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

other info1 :

Species: Homo sapiens (Human)

products description :

The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.The beta subunit contains a C-terminal domain which is involved in cell signaling, through phosphorylations and protein-protein interactions. Modulates signaling in ERK, SRC and NF-kappa-B pathways. In activated T-cells, influences directly or indirectly the Ras/MAPK pathway. Promotes tumor progression. Regulates TP53-mediated transcription and determines cell fate in the genotoxic stress response. Binds, together with KLF4, the PE21 promoter element of TP53 and represses TP53 activity.

ncbi gi num :

324120958

ncbi acc num :

NP_001191215.1

ncbi gb acc num :

NM_001204286.1

uniprot acc num :

P15941

ncbi mol weight :

32kD

ncbi pathways :

IL-7 Signaling Pathway (198857); Metabolism Of Proteins Pathway (106230); O-linked Glycosylation Of Mucins Pathway (530747); Post-translational Protein Modification Pathway (161012); Termination Of O-glycan Biosynthesis Pathway (530748)

ncbi summary :

This gene encodes a membrane-bound protein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in intracellular signaling. This protein is expressed on the apical surface of epithelial cells that line the mucosal surfaces of many different tissues including lung, breast stomach and pancreas. This protein is proteolytically cleaved into alpha and beta subunits that form a heterodimeric complex. The N-terminal alpha subunit functions in cell-adhesion and the C-terminal beta subunit is involved in cell signaling. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. This gene is known to contain a highly polymorphic variable number tandem repeats (VNTR) domain. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2011]

uniprot summary :

MUC1: a large cell surface glycoprotein expressed by most glandular and ductal epithelial cells and some hematopoietic cell lineages. Plays a role in adhesion and cell-cell interactions, metastasis and signaling. May provide a protective layer on epithelial surfaces. Direct or indirect interaction with actin cytoskeleton. Its cytoplasmic tail (MUC1CT) is involved in several signaling pathways, including those involving Ras, beta-catenin, p120 catenin, p53 and estrogen receptor alpha. MUC1CT also forms complexes with transcription factors, and then translocates to the nucleus by an unknown mechanism, where it is believed to influence the transcription of their target genes. MUC1CT has also been proposed to localize to mitochondrial membranes under conditions of genotoxic stress, where it attenuates the apoptotic pathway in response and confers resistance to apoptosis-inducing drugs. Aberrantly glycosylated forms expressed in human epithelial tumors, such as breast or ovarian cancer and also in non-epithelial tumor cells. Nine alternatively spliced isoforms have been described. Isoforms 5 and 9 are secreted. Isoform 7, expressed only in tumor cells, is a receptor and binds the secreted isoform 5. The binding induces the phosphorylation of the isoform 7, alters cellular morphology and initiates cell signaling. Can bind to GRB2 adapter protein. Protein type: Cell adhesion; Nuclear receptor co-regulator; Tumor suppressor; Membrane protein, integral; Actin-binding; Motility/polarity/chemotaxis. Chromosomal Location of Human Ortholog: 1q21. Cellular Component: extracellular space; cell surface; integral to plasma membrane; Golgi lumen; nuclear chromatin; apical plasma membrane; cytoplasm; vesicle. Molecular Function: protein binding; p53 binding; transcription cofactor activity. Biological Process: protein amino acid O-linked glycosylation; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator; cellular protein metabolic process; regulation of transcription from RNA polymerase II promoter in response to stress; O-glycan processing; post-translational protein modification; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest. Disease: Medullary Cystic Kidney Disease 1

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.2 mg (E-Coli)

price2 :

490

size3 :

0.5 mg (E-Coli)

price3 :

715

size4 :

0.05 mg (Baculovirus)

price4 :

950

size5 :

1 mg (E-Coli)

price5 :

1170