product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Thrombospondin-2
catalog :
MBS1265501
quantity :
0.05 mg (E-Coli)
price :
185 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1265501
products type :
Recombinant Protein
products full name :
Recombinant Mouse Thrombospondin-2
products short name :
Thrombospondin-2
other names :
thrombospondin-2; Thrombospondin-2; thrombospondin-2; thrombospondin 2
products gene name :
Thbs2
other gene names :
Thbs2; Thbs2; TSP2; Thbs-2; Tsp2
uniprot entry name :
TSP2_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
19-232
sequence length :
1172
sequence :
GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRF
VRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKS
RGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQH
TNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVT
LEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVF
ADSVEDILSKKGCQHSQGA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties.
products references :
Characterization of mouse thrombospondin 2 sequence and expression during cell growth and development.Laherty C.D., O'Rourke K., Wolf F.W., Katz R., Seldin M.F., Dixit V.M.J. Biol. Chem. 267:3274-3281(1992) Genomic sequence analysis in the mouse t-complex region.Brathwaite M., Waeltz P., Qian Y., Dudekula D., Schlessinger D., Nagaraja R. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.A second, expressed thrombospondin gene (Thbs2) exists in the mouse genome.Bornstein P., O'Rourke K., Wikstrom K., Wolf F.W., Katz R., Li P., Dixit V.M.J. Biol. Chem. 266:12821-12824(1991) The antiangiogenic effect of thrombospondin-2 is mediated by CD36 and modulated by histidine-rich glycoprotein.Simantov R., Febbraio M., Silverstein R.L.Matrix Biol. 24:27-34(2005)
ncbi gi num :
239787900
ncbi acc num :
NP_035711.2
ncbi gb acc num :
NM_011581.3
uniprot acc num :
Q03350
ncbi mol weight :
28.2kD
ncbi pathways :
ECM-receptor Interaction Pathway (83265); ECM-receptor Interaction Pathway (479); Focal Adhesion Pathway (198353); Focal Adhesion Pathway (83264); Focal Adhesion Pathway (478); Malaria Pathway (152666); Malaria Pathway (152657); PI3K-Akt Signaling Pathway (692242); PI3K-Akt Signaling Pathway (692979); Phagosome Pathway (153914)
uniprot summary :
THBS2: Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties. Genetic variations in THBS2 may be a cause of susceptibility to intervertebral disk disease (IDD); also known as lumbar disk herniation (LDH). IDD is one of the most common musculo-skeletal disorders and the predominant cause of low-back pain and unilateral leg pain. Belongs to the thrombospondin family. Protein type: Motility/polarity/chemotaxis. Cellular Component: basement membrane; extracellular matrix; extracellular region; proteinaceous extracellular matrix. Molecular Function: calcium ion binding; heparin binding; protein binding. Biological Process: cell adhesion; negative regulation of angiogenesis; positive regulation of synaptogenesis
size1 :
0.05 mg (E-Coli)
price1 :
185 USD
size2 :
0.2 mg (E-Coli)
price2 :
420
size3 :
0.5 mg (E-Coli)
price3 :
680
size4 :
1 mg (E-Coli)
price4 :
1070
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!