product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Metalloproteinase inhibitor 3 protein
catalog :
MBS1265488
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1265488
products type :
Recombinant Protein
products full name :
Recombinant Human Metalloproteinase inhibitor 3 protein
products short name :
Metalloproteinase inhibitor 3
products name syn :
Protein MIG-5; Tissue inhibitor of metalloproteinases 3; TIMP-3
other names :
metalloproteinase inhibitor 3; Metalloproteinase inhibitor 3; metalloproteinase inhibitor 3; TIMP metallopeptidase inhibitor 3; Protein MIG-5; Tissue inhibitor of metalloproteinases 3; TIMP-3
products gene name :
TIMP3
other gene names :
TIMP3; TIMP3; SFD; K222; K222TA2; HSMRK222; TIMP-3
uniprot entry name :
TIMP3_HUMAN
host :
E Coli
sequence positions :
30-208; Partial.
sequence length :
208
sequence :
HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMK
MYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGR
VYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCK
IKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACI
RQKGGYCSWYRGWAPPDKSIINA
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Neuroscience
products description :
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.
products references :
Structure and expression in breast tumors of human TIMP-3, a new member of the metalloproteinase inhibitor family.Uria J.A., Ferrando A.A., Velasco G., Freije J.M., Lopez-Otin C.Cancer Res. 54:2091-2094(1994)
ncbi gi num :
4507513
ncbi acc num :
NP_000353.1
ncbi gb acc num :
NM_000362.4
uniprot acc num :
P35625
ncbi mol weight :
24.9kD
ncbi pathways :
Angiogenesis Pathway (198772); Endochondral Ossification Pathway (198812); Matrix Metalloproteinases Pathway (198900); MicroRNAs In Cancer Pathway (852705); MicroRNAs In Cancer Pathway (852928); Oncostatin M Signaling Pathway (711361); Proteoglycans In Cancer Pathway (782000); Proteoglycans In Cancer Pathway (782054)
ncbi summary :
This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy. [provided by RefSeq, Jul 2008]
uniprot summary :
TIMP3: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15. Interacts with EFEMP1. Belongs to the protease inhibitor I35 (TIMP) family. Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 22q12.3. Cellular Component: basement membrane; cytoplasm; extracellular matrix; extracellular space; nucleus; proteinaceous extracellular matrix. Molecular Function: metal ion binding; metalloendopeptidase inhibitor activity; protease binding; protein binding. Biological Process: aging; central nervous system development; negative regulation of membrane protein ectodomain proteolysis; negative regulation of metalloenzyme activity; response to estrogen stimulus; response to folic acid; response to mechanical stimulus; response to organic substance; tissue regeneration; visual perception. Disease: Fundus Dystrophy, Pseudoinflammatory, Of Sorsby
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!