catalog number :
MBS1265449
products type :
Recombinant Protein
products full name :
Recombinant E.coli Hexokinase-1
products short name :
Hexokinase-1
other names :
hexokinase-1 isoform HKI; Hexokinase-1; hexokinase-1; HK I; glycolytic enzyme; hexokinase type I; brain form hexokinase; hexokinase 1; Brain form hexokinase; Hexokinase type I
other gene names :
HK1; HK1; HKD; HKI; HXK1; HMSNR; HK1-ta; HK1-tb; HK1-tc; HK I
uniprot entry name :
HXK1_HUMAN
sequence :
VHLGPKKPQARKGSMADVPKELMDEIHQLEDMFTVDSET
LRKVVKHFIDELNKGLTKKGGNIPMIPGWVMEFPTGKES
GNYLAIDLGGTNLRVVLVKLSGNHTFDTTQSKYKLPHDM
RTTKHQEELWSFIADSLKDFMVEQELLNTKDTLPLGFTF
SYPASQNKINEGILQRWTKGFDIPNVEGHDVVPLLQNEI
SKRELPIEIVALINDTVGTLIASYYTDPETKMGVIFGTG
VNGAFYDVVSDIEKLEGKLADDIPSNSPMAINCEYGSFD
NEHLVLPRTKYDVAVDEQSPRPGQQAFEKMTSGYYLGEL
LRLVLLELNEKGLMLKDQDLSKLKQPYIMDTSYPARIED
DPFENLEDTDDIFQKDFGVKTTLPERKLIRRLCELIGTR
AARLAVCGIAAICQKRGYKTGHIAADGSVYNKYPGFKEA
AAKGLRDIYGWTGDASKDPITIVPAEDGSGAGAAVIAAL
SEKRIAEGKSLGIIGA
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
ncbi acc num :
NP_000179.2
ncbi gb acc num :
NM_000188.2
ncbi mol weight :
102,486 Da
ncbi pathways :
Amino Sugar And Nucleotide Sugar Metabolism Pathway (82979); Amino Sugar And Nucleotide Sugar Metabolism Pathway (350); Butirosin And Neomycin Biosynthesis Pathway (145809); Butirosin And Neomycin Biosynthesis Pathway (145786); Carbohydrate Digestion And Absorption Pathway (170720); Carbohydrate Digestion And Absorption Pathway (170654); Carbon Metabolism Pathway (814926); Carbon Metabolism Pathway (817567); Conversion Of Glucose To Acetyl CoA And Entry Into The TCA Cycle Pathway (835393); Fructose And Mannose Metabolism Pathway (82930)
ncbi summary :
Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in five transcript variants which encode different isoforms, some of which are tissue-specific. Each isoform has a distinct N-terminus; the remainder of the protein is identical among all the isoforms. A sixth transcript variant has been described, but due to the presence of several stop codons, it is not thought to encode a protein. [provided by RefSeq, Apr 2009]
uniprot summary :
HK1: a glycolytic enzyme that catalyzes the reaction ATP + D-hexose = ADP + D-hexose 6-phosphate. The first and rate-limiting step in glycosis, a pathway that produces energy in the form of ATP from glucose. An allosteric enzyme inhibited by its product glucose-6-phosphate (Glc-6-P). HK-2 and its mitochondrial receptor (VDAC) play the most pivotal and direct roles in the Warburg effect . Acts as a glucose sensor by trapping glucose inside the cell by catalyzing its phosphorylation to produce Glc-6-P. In vertebrates there are four major glucose-phosphorylating isoenzymes, designated hexokinase I, II, III and IV (glucokinase). Four human isoforms are produced by alternative splicing and alternative initiation. Isoform HK1 is markedly elevated in rapidly growing tumor cells exhibiting high glucose catabolic rates. HK1 is present in most tissues but is especially prominent in brain and kidney. Isoform HK1-SC is is an integral membrane protein detected in round spermatids, condensing spermatids and mature sperm where it is found in the head membranes, mitochondria of the midpiece and the fibrous sheath of the flagellum. Isoform HK1-SA is first expressed during meiosis and continues to be present in postmeiotic germ cells while isoform HK1-SB is present only in postmeiotic germ cells. Protein type: Carbohydrate Metabolism - galactose; Carbohydrate Metabolism - fructose and mannose; EC 2.7.1.1; Carbohydrate Metabolism - starch and sucrose; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Kinase, other; Carbohydrate Metabolism - amino sugar and nucleotide sugar; Mitochondrial. Chromosomal Location of Human Ortholog: 10q22. Cellular Component: mitochondrial outer membrane; mitochondrion; cytosol; lipid raft. Molecular Function: protein binding; hexokinase activity; mannokinase activity; fructokinase activity; glucokinase activity; ATP binding. Biological Process: hexose metabolic process; glycolysis; hexose transport; glucose 6-phosphate metabolic process; carbohydrate phosphorylation; carbohydrate metabolic process; cell glucose homeostasis; pathogenesis; glucose transport; transmembrane transport. Disease: Hemolytic Anemia, Nonspherocytic, Due To Hexokinase Deficiency; Neuropathy, Hereditary Motor And Sensory, Russe Type