product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Glutamate carboxypeptidase 2
catalog :
MBS1265437
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS1265437
products type :
Recombinant Protein
products full name :
Recombinant Human Glutamate carboxypeptidase 2
products short name :
Glutamate carboxypeptidase 2
products name syn :
Cell growth-inhibiting gene 27 protein; Folate hydrolase 1; Folylpoly-gamma-glutamate carboxypeptidase; FGCP; Glutamate carboxypeptidase II; GCPII; Membrane glutamate carboxypeptidase; mGCP; N-acetylated-alpha-linked acidic dipeptidase I; NAALADase I; Prostate-specific membrane antigen; PSM; PSMA; Pteroylpoly-gamma-glutamate carboxypeptidase
other names :
glutamate carboxypeptidase 2 isoform 2; Glutamate carboxypeptidase 2; glutamate carboxypeptidase 2; folate hydrolase (prostate-specific membrane antigen) 1; Cell growth-inhibiting gene 27 protein; Folate hydrolase 1; Folylpoly-gamma-glutamate carboxypeptidase; FGCP; Glutamate carboxypeptidase II; GCPII; Membrane glutamate carboxypeptidase; mGCP; N-acetylated-alpha-linked acidic dipeptidase I; NAALADase I; Prostate-specific membrane antigen; PSM; PSMA; Pteroylpoly-gamma-glutamate carboxypeptidase
products gene name :
FOLH1
products gene name syn :
FOLH; NAALAD1; PSM; PSMA
other gene names :
FOLH1; FOLH1; PSM; FGCP; FOLH; GCP2; PSMA; mGCP; GCPII; NAALAD1; NAALAdase; FOLH; NAALAD1; PSM; PSMA; FGCP; GCPII; mGCP; NAALADase I; PSM; PSMA
uniprot entry name :
FOLH1_HUMAN
host :
E Coli
sequence positions :
48-750, Partial.
sequence length :
750
sequence :
EATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGT
EQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHP
NYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAF
SPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIA
RYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSY
PDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRR
GIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWR
GSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVI
GTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEI
VRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEE
NSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHN
LTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKL
GSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHS
VYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVL
PFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSL
FSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFL
ERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYD
ALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEV
A
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Cancer
products description :
Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Isoform PSM-4 and isoform PSM-5 would appear to be physiologically irrelevant. Involved in prostate tumor progression. Also exhibits a dipeptidyl-peptidase IV type activity. In vitro, cleaves Gly-Pro-AMC.
products references :
Molecular cloning of a complementary DNA encoding a prostate-specific membrane antigen.Israeli R.S., Powell C.T., Fair W.R., Heston W.D.W.Cancer Res. 53:227-230(1993) Alternatively spliced variants of prostate-specific membrane antigen RNA ratio of expression as a potential measurement of progression.Su S.L., Huang I.-P., Fair W.R., Powell C.T., Heston W.D.W.Cancer Res. 55:1441-1443(1995) Mapping, genomic organization and promoter analysis of the human prostate-specific membrane antigen gene.O'Keefe D.S., Su S.L., Bacich D.J., Horiguchi Y., Luo Y., Powell C.T., Zandvliet D., Russell P.J., Molloy P.L., Nowak N.J., Shows T.B., Mullins C., Vonder Haar R.A., Fair W.R., Heston W.D.W.Biochim. Biophys. Acta 1443:113-127(1998) Molecular characterization of human brain N-acetylated alpha-linked acidic dipeptidase (NAALADase) .Luthi-Carter R., Barczak A.K., Speno H., Coyle J.T.J. Pharmacol. Exp. Ther. 286:1020-1025(1998) Isolation and expression of novel human glutamate carboxypeptidases with N-acetylated alpha-linked acidic dipeptidase and dipeptidyl peptidase IV activity.Pangalos M.N., Neefs J.-M., Somers M., Verhasselt P., Bekkers M., van der Helm L., Fraiponts E., Ashton D., Gordon R.D.J. Biol. Chem. 274:8470-8483(1999) Glutamate carboxypeptidase II a polymorphism associated with lower levels of serum folate and hyperhomocysteinemia.Devlin A.M., Ling E.-H., Peerson J.M., Fernando S., Clarke R., Smith A.D., Halsted C.H.Hum. Mol. Genet. 9:2837-2844(2000) Cloning and sequencing of Chinese prostate-specific membrane antigen.Ye C.Z., Zhang F.L., Zhang Y.K., Chen C.Q.Mian Yi Xue Za Zhi 17:328-330(2001) High expression of PSM-E correlated with tumor grade in prostate cancer a new alternatively spliced variant of prostate-specific membrane antigen.Cao K.Y., Mao X.P., Wang D.H., Xu L., Yuan G.Q., Dai S.Q., Zheng B.J., Qiu S.P.Prostate 67:1791-1800(2007) Identification of three novel splice variants of prostate-specific membrane antigen.Peace D.J., Zhang Y., Holt G., Ferrer K.T., Heller M., Sosman J.A., Xue B.H.Identification of a cell growth-inhibiting gene.Kim J.W., Kim H.K., Shin S.M.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)
ncbi gi num :
62548858
ncbi acc num :
NP_001014986.1
ncbi gb acc num :
NM_001014986.1
uniprot acc num :
Q04609
ncbi mol weight :
83.2kD
ncbi pathways :
Alanine, Aspartate And Glutamate Metabolism Pathway (101142); Alanine, Aspartate And Glutamate Metabolism Pathway (100063); Amino Acid Synthesis And Interconversion (transamination) Pathway (1270159); Metabolic Pathways (132956); Metabolism Pathway (1269956); Metabolism Of Amino Acids And Derivatives Pathway (1270158); One Carbon Metabolism Pathway (198756); Vitamin Digestion And Absorption Pathway (199556); Vitamin Digestion And Absorption Pathway (199538)
ncbi summary :
This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants encoding several different isoforms. [provided by RefSeq, Jul 2010]
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!