Recombinant Human Tenascin | MyBioSource MBS1265425 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Tenascin

catalog :

MBS1265425

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1265425

products type :

Recombinant Protein

products full name :

Recombinant Human Tenascin

products short name :

Tenascin

products name syn :

Cytotactin; GMEM; GP 150-225; Glioma-associated-extracellular matrix antigen; Hexabrachion; JI; Myotendinous antigen; Neuronectin; Tenascin-C; TN-C

other names :

tenascin; Tenascin; tenascin; tenascin C; Cytotactin; GMEM; GP 150-225; Glioma-associated-extracellular matrix antigen; Hexabrachion; JI; Myotendinous antigen; Neuronectin; Tenascin-C; TN-C

products gene name :

TNC

other gene names :

TNC; TNC; GP; JI; TN; HXB; GMEM; TN-C; DFNA56; 150-225; HXB; TN; TN-C

uniprot entry name :

TENA_HUMAN

host :

E Coli

sequence positions :

1888-2201; Fragment at the N-terminal;

sequence length :

2201

sequence :

DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDG
TVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSN
MIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNG
DKAEALEVFCDMTSDGGGWIVFLRRKNRENFYQNWKAYA
AGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETA
FAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSF
STFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDN
NHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKR
A

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Signal Transduction

products description :

Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6.

products references :

The complete cDNA sequence of human hexabrachion (Tenascin) . A multidomain protein containing unique epidermal growth factor repeats.Nies D.E., Hemesath T.J., Kim J.H., Gulcher J.R., Stefansson K.J. Biol. Chem. 266:2818-2823(1991) Human tenascin primary structure, pre-mRNA splicing patterns and localization of the epitopes recognized by two monoclonal antibodies.Siri A., Carnemolla B., Saginati M., Leprini A., Casari G., Baralle F., Zardi L.Nucleic Acids Res. 19:525-531(1991) Structure of the human hexabrachion (tenascin) gene.Gulcher J.R., Nies D.E., Alexakos M.J., Ravikant N.A., Sturgill M.E., Marton L.S., Stefansson K.Proc. Natl. Acad. Sci. U.S.A. 88:9438-9442(1991) Human tenascin gene. Structure of the 5'-region, identification, and characterization of the transcription regulatory sequences.Gherzi R., Carnemolla B., Siri A., Ponassi M., Balza E., Zardi L.J. Biol. Chem. 270:3429-3434(1995) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004) Analysis of aggrecan and tenascin gene expression in mouse skeletal tissues by northern and in situ hybridization using species specific cDNA probes.Glumoff V., Savontaus M., Vehanen J., Vuorio E.Biochim. Biophys. Acta 1219:613-622(1994) An alternatively spliced region of the human hexabrachion contains a repeat of potential N-glycosylation sites.Gulcher J.R., Nies D.E., Marton L.S., Stefansson K.Proc. Natl. Acad. Sci. U.S.A. 86:1588-1592(1989) Binding of the NG2 proteoglycan to type VI collagen and other extracellular matrix molecules.Burg M.A., Tillet E., Timpl R., Stallcup W.B.J. Biol. Chem. 271:26110-26116(1996) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005) Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F.Proteomics 8:3833-3847(2008) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Structure of a fibronectin type III domain from tenascin phased by MAD analysis of the selenomethionyl protein.Leahy D.J., Hendrickson W.A., Aukhil I., Erickson H.P.Science 258:987-991(1992) Exome sequencing and linkage analysis identified tenascin-C (TNC) as a novel causative gene in nonsyndromic hearing loss.Zhao Y., Zhao F., Zong L., Zhang P., Guan L., Zhang J., Wang D., Wang J., Chai W., Lan L., Li Q., Han B., Yang L., Jin X., Yang W., Hu X., Wang X., Li N., Li Y., Petit C., Wang J., Wang H.Y., Wang Q.PLoS ONE 8:E69549-E69549(2013)

ncbi gi num :

153946395

ncbi acc num :

NP_002151.2

ncbi gb acc num :

NM_002160.3

uniprot acc num :

P24821

ncbi mol weight :

39.6kD

ncbi pathways :

ECM Proteoglycans Pathway (1270256); ECM-receptor Interaction Pathway (83068); ECM-receptor Interaction Pathway (479); Extracellular Matrix Organization Pathway (1270244); Focal Adhesion Pathway (198795); Focal Adhesion Pathway (83067); Focal Adhesion Pathway (478); Integrin Cell Surface Interactions Pathway (1270260); MicroRNAs In Cancer Pathway (852705); MicroRNAs In Cancer Pathway (852928)

ncbi summary :

This gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration. [provided by RefSeq, Jul 2011]

uniprot summary :

TNC: Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6. Belongs to the tenascin family. 6 isoforms of the human protein are produced by alternative splicing. Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 9q33. Cellular Component: basement membrane; extracellular matrix; extracellular region; extracellular space; focal adhesion; membrane. Molecular Function: syndecan binding. Biological Process: axon regeneration in the peripheral nervous system; cell adhesion; extracellular matrix organization and biogenesis; negative regulation of cell adhesion; neuromuscular junction development; odontogenesis of dentine-containing teeth; osteoblast differentiation; positive regulation of cell proliferation; response to ethanol; response to mechanical stimulus; response to wounding; wound healing. Disease: Deafness, Autosomal Dominant 56

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.2 mg (E-Coli)

price2 :

490

size3 :

0.5 mg (E-Coli)

price3 :

715

size4 :

1 mg (E-Coli)

price4 :

1170

more info or order :

MyBioSource product webpage