Recombinant human Potassium voltage-gated channel subfamily A member 1 protein | MyBioSource MBS1265383 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant human Potassium voltage-gated channel subfamily A member 1 protein

catalog :

MBS1265383

quantity :

0.05 mg (E-Coli)

price :

195 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1265383

products type :

Recombinant Protein

products full name :

Recombinant human Potassium voltage-gated channel subfamily A member 1 protein

products short name :

Potassium voltage-gated channel subfamily A member 1 protein

other names :

potassium voltage-gated channel subfamily A member 1; Potassium voltage-gated channel subfamily A member 1; potassium voltage-gated channel subfamily A member 1; voltage-gated K(+) channel HuKI; voltage-gated potassium channel HBK1; voltage-gated potassium channel subunit Kv1.1; potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia); Voltage-gated K(+) channel HuKI; Voltage-gated potassium channel HBK1; Voltage-gated potassium channel subunit Kv1.1

other gene names :

KCNA1; KCNA1; EA1; MK1; AEMK; HBK1; HUK1; MBK1; RBK1; KV1.1

uniprot entry name :

KCNA1_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence :

MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERV
VINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRN
EYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEI
KFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVW

purity :

>90%(SDS-PAGE)

storage stability :

Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

products description :

Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.

ncbi gi num :

119395748

ncbi acc num :

NP_000208.2

ncbi gb acc num :

NM_000217.2

uniprot acc num :

Q09470

ncbi mol weight :

22kD

ncbi pathways :

Neuronal System Pathway (106513); Potassium Channels Pathway (366221); Voltage Gated Potassium Channels Pathway (366230)

ncbi summary :

This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). [provided by RefSeq, Jul 2008]

uniprot summary :

Kv1.1: Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Defects in KCNA1 are the cause of episodic ataxia type 1 (EA1); also known as paroxysmal or episodic ataxia with myokymia (EAM) or paroxysmal ataxia with neuromyotonia. EA1 is an autosomal dominant disorder characterized by brief episodes of ataxia and dysarthria. Neurological examination during and between the attacks demonstrates spontaneous, repetitive discharges in the distal musculature (myokymia) that arise from peripheral nerve. Nystagmus is absent. Defects in KCNA1 are the cause of myokymia isolated type 1 (MK1). Myokymia is a condition characterized by spontaneous involuntary contraction of muscle fiber groups that can be observed as vermiform movement of the overlying skin. Electromyography typically shows continuous motor unit activity with spontaneous oligo- and multiplet-discharges of high intraburst frequency (myokymic discharges). Isolated spontaneous muscle twitches occur in many persons and have no grave significance. Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.1/KCNA1 sub-subfamily. Protein type: Membrane protein, integral; Membrane protein, multi-pass; Channel, potassium. Chromosomal Location of Human Ortholog: 12p13.32. Cellular Component: voltage-gated potassium channel complex; cell surface; endoplasmic reticulum; integral to plasma membrane; paranode region of axon; cytoplasmic membrane-bound vesicle; dendrite; integral to membrane; perikaryon; cytosol; presynaptic membrane; cell soma; apical plasma membrane; plasma membrane; synapse; nerve terminal; cell junction. Molecular Function: protein binding; voltage-gated potassium channel activity; potassium channel activity; delayed rectifier potassium channel activity; potassium ion transmembrane transporter activity. Biological Process: detection of mechanical stimulus involved in sensory perception of pain; synaptic transmission; regulation of membrane potential; regulation of muscle contraction; neuromuscular process; generation of action potential; protein homooligomerization; potassium ion transport; detection of mechanical stimulus involved in sensory perception of touch. Disease: Episodic Ataxia, Type 1

size1 :

0.05 mg (E-Coli)

price1 :

195 USD

size2 :

0.2 mg (E-Coli)

price2 :

465

size3 :

0.5 mg (E-Coli)

price3 :

815

size4 :

1 mg (E-Coli)

price4 :

1290

more info or order :

MyBioSource product webpage