protein

Recombinant Human Asialoglycoprotein receptor 1

MBS1265368

0.05 mg (E-Coli)

180 USD

Recombinant Protein

Recombinant Human Asialoglycoprotein receptor 1

Asialoglycoprotein receptor 1

C-type lectin domain family 4 member H1; Hepatic lectin H1; HL-1

asialoglycoprotein receptor 1 isoform b; Asialoglycoprotein receptor 1; asialoglycoprotein receptor 1; asialoglycoprotein receptor 1; C-type lectin domain family 4 member H1; Hepatic lectin H1; HL-1

ASGR1

CLEC4H1

ASGR1; ASGR1; HL-1; ASGPR; ASGPR1; CLEC4H1; CLEC4H1; ASGP-R 1; ASGPR 1; HL-1

ASGR1_HUMAN

E Coli

68-291

252

EELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLE
SQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQ
GNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRL
EDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKW
VDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDG
RWNDDVCQRPYRWVCETELDKASQEPPLL

Greater than 90% as determined by SDS-PAGE.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Signal Transduction

Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been roved. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.

Sequence of human asialoglycoprotein receptor cDNA. An internal signal sequence for membrane insertion.Spiess M., Schwartz A.L., Lodish H.F.J. Biol. Chem. 260:1979-1982(1985) An internal signal sequence the asialoglycoprotein receptor membrane anchor.Spiess M., Lodish H.F.Cell 44:177-185(1986) Human asialoglycoprotein receptor 1 gene is expressed in SH-SY5Y human neuroblastoma cells.Wang H., Gao X., Li L., Lou H., Huang Y., Wang B., Han J.A new splice variant of the major subunit of human asialoglycoprotein receptor encodes a secreted form in hepatocytes.Liu J., Hu B., Yang Y., Ma Z., Yu Y., Liu S., Wang B., Zhao X., Lu M., Yang D.PLoS ONE 5:E12934-E12934(2010) DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.Nature 440:1045-1049(2006) Fatty acylation of the rat and human asialoglycoprotein receptors. A conserved cytoplasmic cysteine residue is acylated in all receptor subunits.Zeng F.Y., Weigel P.H.J. Biol. Chem. 271:32454-32460(1996) Cloning, mapping, and characterization of a human homologue of the yeast longevity assurance gene LAG1.Pan H., Qin W.-X., Huo K.-K., Wan D.-F., Yu Y., Xu Z.-G., Hu Q.-D., Gu K.T., Zhou X.-M., Jiang H.-Q., Zhang P.-P., Huang Y., Li Y.-Y., Gu J.-R.Genomics 77:58-64(2001) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Crystal structure of the carbohydrate recognition domain of the H1 subunit of the asialoglycoprotein receptor.Meier M., Bider M.D., Malashkevich V.N., Spiess M., Burkhard P.J. Mol. Biol. 300:857-865(2000)

308387363

NP_001184145.1

NM_001197216.2

P07306

29.8kD

Thyroid Hormone Synthesis Pathway (835410); Thyroid Hormone Synthesis Pathway (839541)

This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the more abundant major subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]

ASGR1: Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface. Protein type: Membrane protein, integral. Chromosomal Location of Human Ortholog: 17p13.2. Cellular Component: extracellular region; integral to plasma membrane. Molecular Function: asialoglycoprotein receptor activity; carbohydrate binding; metal ion binding; protein binding; protein homodimerization activity. Biological Process: cellular response to extracellular stimulus; receptor-mediated endocytosis

0.05 mg (E-Coli)

180 USD

0.2 mg (E-Coli)

410

0.5 mg (E-Coli)

665

1 mg (E-Coli)

1050