Recombinant Human Endoplasmin (HSP90B1), partial | MyBioSource MBS1265357 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Endoplasmin (HSP90B1), partial

catalog :

MBS1265357

quantity :

0.01 mg

price :

160 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS1265357

products type :

Recombinant Protein

products full name :

Recombinant Human Endoplasmin (HSP90B1), partial

products short name :

[Endoplasmin (HSP90B1)]

products name syn :

[94 kDa glucose-regulated protein; GRP-94; Heat shock protein 90 kDa beta member 1; Tumor rejection antigen 1; gp96 homolog]

other names :

[endoplasmin; Endoplasmin; endoplasmin; heat shock protein 90kDa beta family member 1; 94 kDa glucose-regulated protein; GRP-94; Heat shock protein 90 kDa beta member 1; Tumor rejection antigen 1; gp96 homolog]

products gene name :

[HSP90B1]

products gene name syn :

[GRP94; TRA1]

other gene names :

[HSP90B1; HSP90B1; ECGP; GP96; TRA1; GRP94; HEL35; HEL-S-125m; GRP94; TRA1; GRP-94]

uniprot entry name :

ENPL_HUMAN

host :

E Coli

sequence positions :

[27-799. Partial]

sequence length :

799

sequence :

VDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQ
IRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLREL
ISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKN
LLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQ
EDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQH
IWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLE
LDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAA
KEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMND
IKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTA
EGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRV
FITDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHK
LLKVIRKKLVRKTLDMIKKIADDKYNDTFWKEFGTNIKL
GVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKE
KQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPV
DEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAV
EKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVAS
QYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINP
RHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYL
LPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETA
EDTTEDTEQDEDEEMDVGTDEEEETAKESTAE

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

image1 heading :

SDS-Page

products categories :

Metabolism

products description :

Molecular chaperone that functions in the processing and transport of secreted proteins. When associated with CNPY3, required for proper folding of Toll-like receptors. Functions in endoplasmic reticulum associated degradation (ERAD). Has ATPase activity. 1 Publication

products references :

Human homologue of murine tumor rejection antigen gp96 5'-regulatory and coding regions and relationship to stress-induced proteins.Maki R.G., Old L.J., Srivastava P.K.Proc. Natl. Acad. Sci. U.S.A. 87:5658-5662(1990) Glucose-regulated protein (GRP94 and GRP78) genes share common regulatory domains and are coordinately regulated by common trans-acting factors.Chang S.C., Erwin A.E., Lee A.S.Mol. Cell. Biol. 9:2153-2162(1989) The association of heat shock protein gp96 with HBV-derived peptides in vitro.Meng S., Tien P. Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.Nat. Biotechnol. 21:566-569(2003) A subset of chaperones and folding enzymes form multiprotein complexes in endoplasmic reticulum to bind nascent proteins.Meunier L., Usherwood Y.-K., Chung K.T., Hendershot L.M.Mol. Biol. Cell 13:4456-4469(2002) Proteomic analysis of early melanosomes identification of novel melanosomal proteins.Basrur V., Yang F., Kushimoto T., Higashimoto Y., Yasumoto K., Valencia J., Muller J., Vieira W.D., Watabe H., Shabanowitz J., Hearing V.J., Hunt D.F., Appella E.J. Proteome Res. 2:69-79(2003) Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.Zhang H., Li X.-J., Martin D.B., Aebersold R.Nat. Biotechnol. 21:660-666(2003) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Folding of Toll-like receptors by the HSP90 paralogue gp96 requires a substrate-specific cochaperone.Liu B., Yang Y., Qiu Z., Staron M., Hong F., Li Y., Wu S., Li Y., Hao B., Bona R., Han D., Li Z.Nat. Commun. 1:79-79(2010) ErratumLiu B., Yang Y., Qiu Z., Staron M., Hong F., Li Y., Wu S., Li Y., Hao B., Bona R., Han D., Li Z.Nat. Commun. 3:653-653(2012) Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.Chi A., Valencia J.C., Hu Z.-Z., Watabe H., Yamaguchi H., Mangini N.J., Huang H., Canfield V.A., Cheng K.C., Yang F., Abe R., Yamagishi S., Shabanowitz J., Hearing V.J., Wu C., Appella E., Hunt D.F.J. Proteome Res. 5:3135-3144(2006) Elucidation of N-glycosylation sites on human platelet proteins a glycoproteomic approach.Lewandrowski U., Moebius J., Walter U., Sickmann A.Mol. Cell. Proteomics 5:226-233(2006) OS-9 and GRP94 deliver mutant alpha1-antitrypsin to the Hrd1-SEL1L ubiquitin ligase complex for ERAD.Christianson J.C., Shaler T.A., Tyler R.E., Kopito R.R.Nat. Cell Biol. 10:272-282(2008) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3(2011) A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.Cloutier P., Lavallee-Adam M., Faubert D., Blanchette M., Coulombe B.PLoS Genet. 9:E1003210-E1003210(2013) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

ncbi gi num :

4507677

ncbi acc num :

NP_003290.1

ncbi gb acc num :

NM_003299.2

uniprot acc num :

P14625

ncbi mol weight :

93.2kD

ncbi pathways :

ATF6-alpha Activates Chaperone Genes Pathway (1268758); ATF6-alpha Activates Chaperones Pathway (1268757); Binding And Uptake Of Ligands By Scavenger Receptors Pathway (1269897); Estrogen Signaling Pathway (799177); Estrogen Signaling Pathway (799197); IL6-mediated Signaling Events Pathway (137932); Immune System Pathway (1269170); Innate Immune System Pathway (1269203); Metabolism Of Proteins Pathway (1268677); NOD-like Receptor Signaling Pathway (122191)

size1 :

0.01 mg

price1 :

160 USD

size2 :

0.05 mg

price2 :

200

size3 :

0.1 mg

price3 :

295

size4 :

0.2 mg

price4 :

480

size5 :

0.5 mg

price5 :

790

size6 :

1 mg

price6 :

1215

more info or order :

MyBioSource product webpage