product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Monkey IL-17A protein
catalog :
MBS1265350
quantity :
0.05 mg (E-Coli)
price :
185 USD
more info or order :
product information
catalog number :
MBS1265350
products type :
Recombinant Protein
products full name :
Recombinant Monkey IL-17A protein
products short name :
IL-17A
other names :
Uncharacterized protein; interleukin-17A; Uncharacterized protein
products gene name :
Il17a
products gene name syn :
Ctla8; Il17
other gene names :
IL17A; IL17A
uniprot entry name :
F6T3G5_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
24-155
sequence length :
155
sequence :
GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKR
SSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVN
ADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILV
SVGCTCVTPIVHHVA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products references :
Evolutionary and biomedical insights from the rhesus macaque genome.Gibbs R.A., Rogers J., Katze M.G., Bumgarner R., Weinstock G.M., Mardis E.R., Remington K.A., Strausberg R.L., Venter J.C., Wilson R.K., Batzer M.A., Bustamante C.D., Eichler E.E., Hahn M.W., Hardison R.C., Makova K.D., Miller W., Milosavljevic A., Palermo R.E., Siepel A., Sikela J.M., Attaway T., Bell S., Bernard K.E., Buhay C.J., Chandrabose M.N., Dao M., Davis C., Delehaunty K.D., Ding Y., Dinh H.H., Dugan-Rocha S., Fulton L.A., Gabisi R.A., Garner T.T., Godfrey J., Hawes A.C., Hernandez J., Hines S., Holder M., Hume J., Jhangiani S.N., Joshi V., Khan Z.M., Kirkness E.F., Cree A., Fowler R.G., Lee S., Lewis L.R., Li Z., Liu Y.-S., Moore S.M., Muzny D., Nazareth L.V., Ngo D.N., Okwuonu G.O., Pai G., Parker D., Paul H.A., Pfannkoch C., Pohl C.S., Rogers Y.-H.C., Ruiz S.J., Sabo A., Santibanez J., Schneider B.W., Smith S.M., Sodergren E., Svatek A.F., Utterback T.R., Vattathil S., Warren W., White C.S., Chinwalla A.T., Feng Y., Halpern A.L., Hillier L.W., Huang X., Minx P., Nelson J.O., Pepin K.H., Qin X., Sutton G.G., Venter E., Walenz B.P., Wallis J.W., Worley K.C., Yang S.-P., Jones S.M., Marra M.A., Rocchi M., Schein J.E., Baertsch R., Clarke L., Csuros M., Glasscock J., Harris R.A., Havlak P., Jackson A.R., Jiang H., Liu Y., Messina D.N., Shen Y., Song H.X.-Z., Wylie T., Zhang L., Birney E., Han K., Konkel M.K., Lee J., Smit A.F.A., Ullmer B., Wang H., Xing J., Burhans R., Cheng Z., Karro J.E., Ma J., Raney B., She X., Cox M.J., Demuth J.P., Dumas L.J., Han S.-G., Hopkins J., Karimpour-Fard A., Kim Y.H., Pollack J.R., Vinar T., Addo-Quaye C., Degenhardt J., Denby A., Hubisz M.J., Indap A., Kosiol C., Lahn B.T., Lawson H.A., Marklein A., Nielsen R., Vallender E.J., Clark A.G., Ferguson B., Hernandez R.D., Hirani K., Kehrer-Sawatzki H., Kolb J., Patil S., Pu L.-L., Ren Y., Smith D.G., Wheeler D.A., Schenck I., Ball E.V., Chen R., Cooper D.N., Giardine B., Hsu F., Kent W.J., Lesk A., Nelson D.L., O'brien W.E., Pruefer K., Stenson P.D., Wallace J.C., Ke H., Liu X.-M., Wang P., Xiang A.P., Yang F., Barber G.P., Haussler D., Karolchik D., Kern A.D., Kuhn R.M., Smith K.E., Zwieg A.S.Science 316:222-234(2007) Genome sequencing and comparison of two nonhuman primate animal models, the cynomolgus and Chinese rhesus macaques.Yan G., Zhang G., Fang X., Zhang Y., Li C., Ling F., Cooper D.N., Li Q., Li Y., van Gool A.J., Du H., Chen J., Chen R., Zhang P., Huang Z., Thompson J.R., Meng Y., Bai Y., Wang J., Zhuo M., Wang T., Huang Y., Wei L., Li J., Wang Z., Hu H., Yang P., Le L., Stenson P.D., Li B., Liu X., Ball E.V., An N., Huang Q., Zhang Y., Fan W., Zhang X., Li Y., Wang W., Katze M.G., Su B., Nielsen R., Yang H., Wang J., Wang X., Wang J.Nat. Biotechnol. 29:1019-1023(2011)
ncbi acc num :
XP_001106391.1
uniprot acc num :
F6T3G5
ncbi mol weight :
42.5kD
ncbi pathways :
Cytokine-cytokine Receptor Interaction Pathway (86721); Cytokine-cytokine Receptor Interaction Pathway (460); Inflammatory Bowel Disease (IBD) Pathway (842776); Inflammatory Bowel Disease (IBD) Pathway (842797); Rheumatoid Arthritis Pathway (200311); Rheumatoid Arthritis Pathway (200269)
size1 :
0.05 mg (E-Coli)
price1 :
185 USD
size2 :
0.2 mg (E-Coli)
price2 :
420
size3 :
0.5 mg (E-Coli)
price3 :
680
size4 :
1 mg (E-Coli)
price4 :
1070
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!