product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Stanniocalcin-1 protein
catalog :
MBS1265316
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
product information
catalog number :
MBS1265316
products type :
Recombinant Protein
products full name :
Recombinant Human Stanniocalcin-1 protein
products short name :
Stanniocalcin-1
other names :
stanniocalcin-1; Stanniocalcin-1; stanniocalcin-1; stanniocalcin 1
products gene name :
STC1
other gene names :
STC1; STC1; STC; STC; STC-1
uniprot entry name :
STC1_HUMAN
host :
E Coli
sequence positions :
39-247; Partial.
sequence length :
247
sequence :
SAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSF
LYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCST
FQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHF
SNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLF
HILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEE
DSPSHIKRTSHESA
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Metabolism
products description :
Stimulates renal phosphate reabsorption, and could therefore prevent hypercalcia.
products references :
A novel human cDNA highly homologous to the fish hormone stanniocalcin.Chang A.C.-M., Janosi J., Hulsbeek M., de Jong D., Jeffrey K.J., Noble J.R., Reddel R.R.Mol. Cell. Endocrinol. 112:241-247(1995) Human stanniocalcin a possible hormonal regulator of mineral metabolism.Olsen H.S., Cepeda M.A., Zhang Q.-Q., Rosen C.A., Vozzolo B.L., Wagner G.F.Proc. Natl. Acad. Sci. U.S.A. 93:1792-1796(1996) Characterization of the human stanniocalcin 1 gene.Jeffrey K.J., Reddel R.R.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) DNA sequence and analysis of human chromosome 8.Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T., Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.Nature 439:331-335(2006) Comparative analysis of mammalian stanniocalcin genes.Varghese R., Wong C.K., Deol H., Wagner G.F., DiMattia G.E.Endocrinology 139:4714-4725(1998) Signal peptide prediction based on analysis of experimentally verified cleavage sites.Zhang Z., Henzel W.J.Protein Sci. 13:2819-2824(2004)
ncbi gi num :
4507265
ncbi acc num :
NP_003146.1
ncbi gb acc num :
NM_003155.2
uniprot acc num :
P52823
ncbi mol weight :
51kD
ncbi summary :
This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The gene contains a 5' UTR rich in CAG trinucleotide repeats. The encoded protein contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate. This gene has altered expression in hepatocellular, ovarian, and breast cancers. [provided by RefSeq, Jul 2008]
uniprot summary :
STC1: Stimulates renal phosphate reabsorption, and could therefore prevent hypercalcemia. Belongs to the stanniocalcin family. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 8p21.2. Cellular Component: apical plasma membrane; cytoplasm; extracellular space; nucleus. Molecular Function: hormone activity. Biological Process: cellular calcium ion homeostasis; decidualization; embryo implantation; endothelial cell morphogenesis; negative regulation of calcium ion transport; negative regulation of cell migration; ossification; response to vitamin D
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.2 mg (E-Coli)
price2 :
490
size3 :
0.5 mg (E-Coli)
price3 :
715
size4 :
1 mg (E-Coli)
price4 :
1170
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!