Recombinant Human HLA class II histocompatibility antigen, DR alpha chain protein | MyBioSource MBS1265308 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human HLA class II histocompatibility antigen, DR alpha chain protein

catalog :

MBS1265308

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1265308

products type :

Recombinant Protein

products full name :

Recombinant Human HLA class II histocompatibility antigen, DR alpha chain protein

products short name :

HLA class II histocompatibility antigen, DR alpha

products name syn :

MHC class II antigen DRA

other names :

HLA class II histocompatibility antigen, DR alpha chain; HLA class II histocompatibility antigen, DR alpha chain; HLA class II histocompatibility antigen, DR alpha chain; major histocompatibility complex, class II, DR alpha; MHC class II antigen DRA

products gene name :

HLA-DRA

products gene name syn :

HLA-DRA1

other gene names :

HLA-DRA; HLA-DRA; MLRW; HLA-DRA1; HLA-DRA1

uniprot entry name :

DRA_HUMAN

host :

E Coli

sequence positions :

28-254

sequence length :

254

sequence :

EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKET
VWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYT
PITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNV
TWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTE
DVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCAL
GLTVGLVGIIIGTIFIIKGLRKSNAAERRGPL

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Immunology

products description :

Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents th on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The roval of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading.

products references :

Sequence of an HLA-DR alpha-chain cDNA clone and intron-exon organization of the corresponding gene.Lee J.S., Trowsdale J., Travers P.J., Carey J., Grosveld F., Jenkins J., Bodmer W.F.Nature 299:750-752(1982)

ncbi gi num :

52426774

ncbi acc num :

NP_061984.2

ncbi gb acc num :

NM_019111.4

uniprot acc num :

P01903

ncbi mol weight :

29.8kD

ncbi pathways :

Adaptive Immune System Pathway (1269171); Allograft Rejection Pathway (920963); Allograft Rejection Pathway (83123); Allograft Rejection Pathway (535); Antigen Processing And Presentation Pathway (83074); Antigen Processing And Presentation Pathway (485); Asthma Pathway (83120); Asthma Pathway (532); Autoimmune Thyroid Disease Pathway (83121); Autoimmune Thyroid Disease Pathway (533)

ncbi summary :

HLA-DRA is one of the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha and a beta chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. DRA does not have polymorphisms in the peptide binding part and acts as the sole alpha chain for DRB1, DRB3, DRB4 and DRB5. [provided by RefSeq, Jul 2008]

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

more info or order :

MyBioSource product webpage