protein

Recombinant Human Cytosolic 5'-nucleotidase 1A

MBS1265289

0.05 mg (Yeast)

190 USD

Recombinant Protein

Recombinant Human Cytosolic 5'-nucleotidase 1A

Cytosolic 5'-nucleotidase 1A

Cytosolic 5'-nucleotidase IA; cN-I; cN-IA

cytosolic 5'-nucleotidase 1A; Cytosolic 5'-nucleotidase 1A; cytosolic 5'-nucleotidase 1A; 5'-nucleotidase, cytosolic IA; Cytosolic 5'-nucleotidase IA; cN-I; cN-IA

NT5C1A

NT5C1A; NT5C1A; CN1; CNI; CN-I; CN1A; CN-IA; cN1A; cN-I; cN-IA

5NT1A_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-368, Full length.

368

MEPGQPREPQEPREPGPGAETAAAPVWEEAKIFYDNLAP
KKKPKSPKPQNAVTIAVSSRALFRMDEEQQIYTEQGVEE
YVRYQLEHENEPFSPGPAFPFVKALEAVNRRLRELYPDS
EDVFDIVLMTNNHAQVGVRLINSINHYDLFIERFCMTGG
NSPICYLKAYHTNLYLSADAEKVREAIDEGIAAATIFSP
SRDVVVSQSQLRVAFDGDAVLFSDESERIVKAHGLDRFF
EHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLEC
PIRTYLVTARSAASSGARALKTLRSWGLETDEALFLAGA
PKGPLLEKIRPHIFFDDQMFHVAGAQEMGTVAAHVPYGV
AQTPRRTAPAKQAPSAQ

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Cardiovascular

Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides and has a broad substrate specificity. Helps to regulate adenosine levels in heart during ischia and hypoxia.

Human cytosolic 5'-nucleotidase I characterization and role in nucleoside analog resistance.Hunsucker S.A., Spychala J., Mitchell B.S.J. Biol. Chem. 276:10498-10504(2001) 5'-nucleotidase I from human heart.Lowenstein J.M., Huang J., Steiner A. The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006)

14210538

NP_115915.1

NM_032526.2

Q9BXI3

45.1kD

Integrated Pancreatic Cancer Pathway (711360); Metabolic Pathways (132956); Metabolism Pathway (1269956); Metabolism Of Nucleotides Pathway (1270133); Nicotinate And Nicotinamide Metabolism Pathway (83014); Nicotinate And Nicotinamide Metabolism Pathway (400); Purine Catabolism Pathway (1270137); Purine Metabolism Pathway (82944); Purine Metabolism Pathway (1270134); Purine Metabolism Pathway (307)

Cytosolic nucleotidases, such as NT5C1A, dephosphorylate nucleoside monophosphates (Hunsucker et al., 2001 [PubMed 11133996]).[supplied by OMIM, Mar 2008]

NT5C1A: Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides and has a broad substrate specificity. Helps to regulate adenosine levels in heart during ischemia and hypoxia. Belongs to the 5'-nucleotidase type 3 family. Protein type: Nucleotide Metabolism - purine; Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; Nucleotide Metabolism - pyrimidine; EC 3.1.3.5; Phosphatase (non-protein). Chromosomal Location of Human Ortholog: 1p34.3-p33. Cellular Component: cytosol. Molecular Function: 5'-nucleotidase activity; magnesium ion binding; nucleotide binding. Biological Process: adenosine metabolic process; dephosphorylation; nucleobase, nucleoside and nucleotide metabolic process; nucleoside metabolic process; purine base metabolic process; purine nucleoside monophosphate catabolic process; purine nucleotide catabolic process; pyrimidine base metabolic process; pyrimidine nucleoside catabolic process

0.05 mg (Yeast)

190 USD

0.05 mg (E-Coli)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750