Recombinant Human Progesterone receptor | MyBioSource MBS1265262 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Progesterone receptor

catalog :

MBS1265262

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1265262

products type :

Recombinant Protein

products full name :

Recombinant Human Progesterone receptor

products short name :

Progesterone receptor

products name syn :

Nuclear receptor subfamily 3 group C member 3

other names :

progesterone receptor isoform B; Progesterone receptor; progesterone receptor; progesterone receptor; Nuclear receptor subfamily 3 group C member 3

products gene name :

PGR

products gene name syn :

NR3C3

other gene names :

PGR; PGR; PR; NR3C3; NR3C3; PR

uniprot entry name :

PRGR_HUMAN

host :

E Coli

sequence positions :

4-232

sequence length :

933

sequence :

LKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTS
DTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLS
DVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLA
PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQR
VLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLP
ASESPHWSGAPVKPSPQAAAVEVEEEDGSESEES

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Transcription

products description :

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Progesterone receptor isoform B (PRB) is involved activation of c-SRC/MAPK signaling on hormone stimulation. Isoform A: inactive in stimulating c-Src/MAPK signaling on hormone stimulation. Isoform 4: Increases mitochondrial membrane potential and cellular respiration upon stimulation by progesterone.

products references :

Two distinct estrogen-regulated promoters generate transcripts encoding the two functionally different human progesterone receptor forms A and B.Kastner P., Krust A., Turcotte B., Stropp U., Tora L., Gronemeyer H., Chambon P.EMBO J. 9:1603-1614(1990) Complete amino acid sequence of the human progesterone receptor deduced from cloned cDNA.Misrahi M., Atger M., D'Auriol L., Loosfelt H., Meriel C., Fridlansky F., Guiochon-Mantel A., Galibert F., Milgrom E.Biochem. Biophys. Res. Commun. 143:740-748(1987) Kieback D.G., Agoulnik I.U., Tong X.-W.Progesterone Receptor, alternative splicing variant, mRNA.Hisatomi H., Wakita K., Kohno N., Nagao K., Hirata H., Hikiji K. The human progesterone receptor shows evidence of adaptive evolution associated with its ability to act as a transcription factor.Chen C., Opazo J.C., Erez O., Uddin M., Santolaya-Forgas J., Goodman M., Grossman L.I., Romero R., Wildman D.E.Mol. Phylogenet. Evol. 47:637-649(2008) Cloning and expression of a novel, truncated, progesterone receptor.Saner K.J., Welter B.H., Zhang F., Hansen E., Dupont B., Wei Y., Price T.M.Mol. Cell. Endocrinol. 200:155-163(2003) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) NIEHS SNPs programHuman chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)

ncbi gi num :

110611914

ncbi acc num :

NP_000917.3

ncbi gb acc num :

NM_000926.4

uniprot acc num :

P06401

ncbi mol weight :

50.7kD

ncbi pathways :

Cellular Roles Of Anthrax Toxin Pathway (138076); Gene Expression Pathway (1269649); Generic Transcription Pathway (1269650); Nuclear Receptor Transcription Pathway (1269652); Nuclear Receptors Pathway (198848); Nuclear Signaling By ERBB4 Pathway (1269499); Oocyte Meiosis Pathway (126909); Oocyte Meiosis Pathway (126872); Ovarian Infertility Genes Pathway (198801); Progesterone-mediated Oocyte Maturation Pathway (119304)

ncbi summary :

This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This gene uses two distinct promotors and translation start sites in the first exon to produce several transcript variants, both protein coding and non-protein coding. Two of the isoforms (A and B) are identical except for an additional 165 amino acids found in the N-terminus of isoform B and mediate their own response genes and physiologic effects with little overlap. [provided by RefSeq, Sep 2015]

uniprot summary :

PR: a nuclear hormone receptor and transcription factor. Regulates gene expression and affects cellular proliferation and differentiation in target tissues. Two splice-variant isoforms have been described. Protein type: DNA-binding; Nuclear receptor. Chromosomal Location of Human Ortholog: 11q22-q23. Cellular Component: mitochondrial outer membrane; nucleoplasm. Molecular Function: ATPase binding; DNA binding; enzyme binding; ligand-dependent nuclear receptor activity; protein binding; receptor binding; steroid binding; steroid hormone receptor activity; zinc ion binding. Biological Process: alveolus development; cell-cell signaling; epithelial cell maturation; gene expression; ovulation from ovarian follicle; positive regulation of transcription from RNA polymerase II promoter; progesterone receptor signaling pathway; regulation of epithelial cell proliferation; signal transduction; steroid hormone mediated signaling; transcription initiation from RNA polymerase II promoter. Disease: Progesterone Resistance

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

more info or order :

MyBioSource product webpage