protein

Recombinant human C-X-C motif chemokine 10 protein

MBS1265249

0.05 mg

195 USD

Recombinant Protein

Recombinant human C-X-C motif chemokine 10 protein

C-X-C motif chemokine 10 protein

C-X-C motif chemokine 10; C-X-C motif chemokine 10; C-X-C motif chemokine 10; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; chemokine (C-X-C motif) ligand 10; 10 kDa interferon gamma-induced protein; Gamma-IP10; IP-10; Small-inducible cytokine B10

CXCL10; CXCL10; C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10; INP10; SCYB10; Gamma-IP10; IP-10

CXL10_HUMAN

E Coli

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV
EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

>90%(SDS-PAGE)

Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C. Notes ? Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

149999382

NP_001556.2

NM_001565.3

P02778

9kD

CXCR3-mediated Signaling Events Pathway (138011); Chemokine Receptors Bind Chemokines Pathway (106359); Chemokine Signaling Pathway (99051); Chemokine Signaling Pathway (96864); Class A/1 (Rhodopsin-like Receptors) Pathway (106357); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Cytosolic DNA-sensing Pathway (125137); Cytosolic DNA-sensing Pathway (124833); G Alpha (i) Signalling Events Pathway (119550)

This gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. [provided by RefSeq, Jul 2008]

CXCL10: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. Belongs to the intercrine alpha (chemokine CxC) family. Protein type: Secreted; Chemokine; Secreted, signal peptide; Motility/polarity/chemotaxis. Chromosomal Location of Human Ortholog: 4q21. Cellular Component: extracellular space; extracellular region; external side of plasma membrane. Molecular Function: heparin binding; protein binding; CXCR3 chemokine receptor binding; chemokine activity; cAMP-dependent protein kinase regulator activity; receptor binding. Biological Process: muscle development; blood circulation; protein secretion; positive regulation of leukocyte chemotaxis; positive regulation of cAMP metabolic process; signal transduction; chemotaxis; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; negative regulation of angiogenesis; response to vitamin D; cell surface receptor linked signal transduction; cell-cell signaling; positive regulation of cell proliferation; response to gamma radiation; immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of release of sequestered calcium ion into cytosol; response to cold; regulation of protein kinase activity; negative regulation of myoblast differentiation; inflammatory response; defense response to virus

0.05 mg

195 USD

0.2 mg

465

0.5 mg

815

1 mg

1290