Recombinant Human Lysyl oxidase homolog 1 (LOXL1), partial | MyBioSource MBS1265229 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Lysyl oxidase homolog 1 (LOXL1), partial

catalog :

MBS1265229

quantity :

0.01 mg (E-Coli)

price :

160 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS1265229

products type :

Recombinant Protein

products full name :

Recombinant Human Lysyl oxidase homolog 1 (LOXL1), partial

products short name :

[Lysyl oxidase homolog 1 (LOXL1)]

products name syn :

[Lysyl oxidase-like protein 1; LOL]

other names :

[lysyl oxidase homolog 1 preproprotein; Lysyl oxidase homolog 1; lysyl oxidase homolog 1; lysyl oxidase like 1; Lysyl oxidase-like protein 1; LOL]

products gene name :

[LOXL1]

other gene names :

[LOXL1; LOXL1; LOL; LOXL; LOXL; LOL]

uniprot entry name :

LOXL1_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

[106-574aa; Partial]

sequence length :

574

sequence :

VGSDTVRGQARHPFGFGQVPDNWREVAVGDSTGMARART
SVSQQRHGGSASSVSASAFASTYRQQPSYPQQFPYPQAP
FVSQYENYDPASRTYDQGFVYYRPAGGGVGAGAAAVASA
GVIYPYQPRARYEEYGGGEELPEYPPQGFYPAPERPYVP
PPPPPPDGLDRRYSHSLYSEGTPGFEQAYPDPGPEAAQA
HGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDT
PPPGGERNGAQQGRLSVGSVYRPNQNGRGLPDLVPDPNY
VQASTYVQRAHLYSLRCAAEEKCLASTAYAPEATDYDVR
VLLRFPQRVKNQGTADFLPNRPRHTWEWHSCHQHYHSMD
EFSHYDLLDAATGKKVAEGHKASFCLEDSTCDFGNLKRY
ACTSHTQGLSPGCYDTYNADIDCQWIDITDVQPGNYILK
VHVNPKYIVLESDFTNNVVRCNIHYTGRYVSATNCKIVQ
S

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

image1 heading :

SDS-PAGE

other info2 :

Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.

products categories :

Metabolism

products description :

Active on elastin and collagen substrates.

products references :

A novel human cDNA with a predicted protein similar to lysyl oxidase maps to chromosome 15q24-q25.Kenyon K., Modi W.S., Contente S., Friedman R.M.J. Biol. Chem. 268:18435-18437(1993) Structure of the human lysyl oxidase-like gene.Kenyon K., Sathya G., Contente S., Friedman R.M. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Analysis of the DNA sequence and duplication history of human chromosome 15.Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A., Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.Nature 440:671-675(2006) Common sequence variants in the LOXL1 gene confer susceptibility to exfoliation glaucoma.Thorleifsson G., Magnusson K.P., Sulem P., Walters G.B., Gudbjartsson D.F., Stefansson H., Jonsson T., Jonasdottir A., Jonasdottir A., Stefansdottir G., Masson G., Hardarson G.A., Petursson H., Arnarsson A., Motallebipour M., Wallerman O., Wadelius C., Gulcher J.R., Thorsteinsdottir U., Kong A., Jonasson F., Stefansson K.Science 317:1397-1400(2007) Ancestral LOXL1 variants are associated with pseudoexfoliation in Caucasian Australians but with markedly lower penetrance than in Nordic people.Hewitt A.W., Sharma S., Burdon K.P., Wang J.J., Baird P.N., Dimasi D.P., Mackey D.A., Mitchell P., Craig J.E.Hum. Mol. Genet. 17:710-716(2008) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Association of LOXL1 gene with Finnish exfoliation syndrome patients.Lemmela S., Forsman E., Onkamo P., Nurmi H., Laivuori H., Kivela T., Puska P., Heger M., Eriksson A., Forsius H., Jarvela I.J. Hum. Genet. 54:289-297(2009)

ncbi gi num :

67782346

ncbi acc num :

NP_005567.2

ncbi gb acc num :

NM_005576.3

uniprot acc num :

Q08397

ncbi mol weight :

55.8kD

ncbi pathways :

Assembly Of Collagen Fibrils And Other Multimeric Structures Pathway (1270247); Collagen Formation Pathway (1270245); Crosslinking Of Collagen Fibrils Pathway (1270249); Elastic Fibre Formation Pathway (1270251); Extracellular Matrix Organization Pathway (1270244)

ncbi summary :

This gene encodes a member of the lysyl oxidase family of proteins. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyzes the first step in the formation of crosslinks in collagen and elastin. The encoded preproprotein is proteolytically processed to generate the mature enzyme. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. Mutations in this gene are associated with exfoliation syndrome. [provided by RefSeq, Jan 2016]

uniprot summary :

LOXL1: Active on elastin and collagen substrates. Genetic variations in LOXL1 are a cause of susceptibility to exfoliation syndrome (XFS); also called exfoliation glaucoma (XFG). XFS is a disorder characterized by accumulation of abnormal fibrillar deposits in the anterior segment of the eye. In addition to being a cause of glaucoma and glaucomatous optic neuropathy, exfoliation syndrome has also been associated with lens zonule weakness, cataract formation, and systemic vascular complications due to deposition of exfoliation material in extraocular tissues. Susceptibility to exfoliation syndrome is conferred by a risk haplotype that includes two LOXL1 coding non-synonymous SNPs (Arg141Leu and Gly153Asp) and one intronic SNP. Arg141Leu and Gly153Asp are sufficient to confer disease susceptibility in some populations. Belongs to the lysyl oxidase family. Protein type: EC 1.4.3.-; Secreted; Oxidoreductase; Secreted, signal peptide; Extracellular matrix. Chromosomal Location of Human Ortholog: 15q22. Cellular Component: acrosome; basement membrane; extracellular matrix; extracellular region; extracellular space. Molecular Function: copper ion binding; oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor. Biological Process: extracellular matrix organization and biogenesis; protein amino acid deamination; response to lipopolysaccharide. Disease: Exfoliation Syndrome

size1 :

0.01 mg (E-Coli)

price1 :

160 USD

size2 :

0.05 mg (E-Coli)

price2 :

200

size3 :

0.1 mg (E-Coli)

price3 :

295

size4 :

0.2 mg (E-Coli)

price4 :

480

size5 :

0.5 mg (E-Coli)

price5 :

790

size6 :

1 mg (E-Coli)

price6 :

1215

more info or order :

MyBioSource product webpage