product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rabbit IL-17A protein
catalog :
MBS1265151
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1265151
products type :
Recombinant Protein
products full name :
Recombinant Rabbit IL-17A protein
products short name :
IL-17A
other names :
PREDICTED: interleukin-17A; Uncharacterized protein; interleukin 17A; Uncharacterized protein
products gene name :
Il17a
products gene name syn :
Ctla8; Il17
other gene names :
IL17A; IL17A
uniprot entry name :
G1SLF2_RABIT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
21-153
sequence length :
153
sequence :
VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSR
RPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCV
NAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKML
VAVGCTCVTPIIHHMA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products references :
Genome Sequence of Oryctolagus cuniculus (European rabbit) .The Genome Sequencing PlatformDi Palma F., Heiman D., Young S., Gnerre S., Johnson J., Lander E.S., Lindblad-Toh K. A high-resolution map of human evolutionary constraint using 29 mammals.Lindblad-Toh K., Garber M., Zuk O., Lin M.F., Parker B.J., Washietl S., Kheradpour P., Ernst J., Jordan G., Mauceli E., Ward L.D., Lowe C.B., Holloway A.K., Clamp M., Gnerre S., Alfoldi J., Beal K., Chang J., Clawson H., Cuff J., Di Palma F., Fitzgerald S., Flicek P., Guttman M., Hubisz M.J., Jaffe D.B., Jungreis I., Kent W.J., Kostka D., Lara M., Martins A.L., Massingham T., Moltke I., Raney B.J., Rasmussen M.D., Robinson J., Stark A., Vilella A.J., Wen J., Xie X., Zody M.C., Baldwin J., Bloom T., Chin C.W., Heiman D., Nicol R., Nusbaum C., Young S., Wilkinson J., Worley K.C., Kovar C.L., Muzny D.M., Gibbs R.A., Cree A., Dihn H.H., Fowler G., Jhangiani S., Joshi V., Lee S., Lewis L.R., Nazareth L.V., Okwuonu G., Santibanez J., Warren W.C., Mardis E.R., Weinstock G.M., Wilson R.K., Delehaunty K., Dooling D., Fronik C., Fulton L., Fulton B., Graves T., Minx P., Sodergren E., Birney E., Margulies E.H., Herrero J., Green E.D., Haussler D., Siepel A., Goldman N., Pollard K.S., Pedersen J.S., Lander E.S., Kellis M.Nature 478:476-482(2011)
ncbi gi num :
291396366
ncbi acc num :
XP_002714544.1
ncbi gb acc num :
XM_002714498.2
uniprot acc num :
G1SLF2
ncbi mol weight :
42.7kD
ncbi pathways :
Cytokine-cytokine Receptor Interaction Pathway (1072805); Cytokine-cytokine Receptor Interaction Pathway (460); Inflammatory Bowel Disease (IBD) Pathway (1072994); Inflammatory Bowel Disease (IBD) Pathway (842797); Rheumatoid Arthritis Pathway (1072997); Rheumatoid Arthritis Pathway (200269)
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (E-Coli)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!