Recombinant Human Intestinal-type alkaline phosphatase | MyBioSource MBS1265148 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Intestinal-type alkaline phosphatase

catalog :

MBS1265148

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1265148

products type :

Recombinant Protein

products full name :

Recombinant Human Intestinal-type alkaline phosphatase

products short name :

Intestinal-type alkaline phosphatase

other names :

intestinal-type alkaline phosphatase; Intestinal-type alkaline phosphatase; intestinal-type alkaline phosphatase; alkaline phosphatase, intestinal

products gene name :

ALPI

other gene names :

ALPI; ALPI; IAP; IAP; Intestinal alkaline phosphatase

uniprot entry name :

PPBI_HUMAN

host :

E Coli

sequence positions :

26-500;Partial.

sequence length :

500

sequence :

ENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLG
VPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYN
VDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNT
TRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAH
TVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILG
GGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAK
HQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIH
RDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHG
HHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTAD
HSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNG
PGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGE
DVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTAC
DLAPPAC

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Signal Transduction

products references :

Cloning and sequencing of human intestinal alkaline phosphatase cDNA.Berger J., Garattini E., Hua J.-C., Udenfriend S.Proc. Natl. Acad. Sci. U.S.A. 84:695-698(1987) Nucleotide and amino acid sequences of human intestinal alkaline phosphatase close homology to placental alkaline phosphatase.Henthorn P.S., Raducha M., Edwards Y.H., Weiss M.J., Slaughter C., Lafferty M.A., Harris H.Proc. Natl. Acad. Sci. U.S.A. 84:1234-1238(1987) Sequence and characterization of the human intestinal alkaline phosphatase gene.Henthorn P.S., Raducha M., Kadesch T., Weiss M.J., Harris H.J. Biol. Chem. 263:12011-12019(1988) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005)

ncbi gi num :

157266292

ncbi acc num :

NP_001622.2

ncbi gb acc num :

NM_001631.4

uniprot acc num :

P09923

ncbi mol weight :

55.6kD

ncbi pathways :

Folate Biosynthesis Pathway (83018); Folate Biosynthesis Pathway (404); Metabolic Pathways (132956)

ncbi summary :

There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is a component of the gut mucosal defense system and is thought to function in the detoxification of lipopolysaccharide, and in the prevention of bacterial translocation in the gut. [provided by RefSeq, Dec 2014]

uniprot summary :

ALPI: intestinal alkaline phosphatase is one of four related alkaline phosphatases. The exact physiological function of alkaline phosphatases is not known. This protein is a GPI-anchored membrane bound glycosylated enzyme that is localized to fetal and adult intestines. Protein type: Phosphatase; Cofactor and Vitamin Metabolism - folate biosynthesis; EC 3.1.3.1; Motility/polarity/chemotaxis; Membrane protein, GPI anchor. Chromosomal Location of Human Ortholog: 2q37.1. Cellular Component: integral to membrane; plasma membrane. Molecular Function: alkaline phosphatase activity; magnesium ion binding; protease binding; protein binding; zinc ion binding. Biological Process: dephosphorylation

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.2 mg (E-Coli)

price2 :

490

size3 :

0.5 mg (E-Coli)

price3 :

715

size4 :

1 mg (E-Coli)

price4 :

1170

more info or order :

MyBioSource product webpage