protein

Recombinant Mouse Thrombospondin-1

MBS1265139

0.05 mg (Yeast)

190 USD

Recombinant Protein

Recombinant Mouse Thrombospondin-1

Thrombospondin-1

Thrombospondin-1; Thrombospondin-1; thrombospondin-1; thrombospondin 1

Thbs1

Thbs1; Thbs1; TSP1; TSP-1; tbsp1; Thbs-1; Tsp1

TSP1_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

19-350; Partial.

350

NRIPESGGDNGVFDIFELIGGARRGPGRRLVKGQDLSSP
AFRIENANLIPAVPDDKFQDLLDAVWADKGFIFLASLRQ
MKKTRGTLLAVERKDNTGQIFSVVSNGKAGTLDLSLSLP
GKQQVVSVEEALLATGQWKSITLFVQEDRAQLYIDCDKM
ESAELDVPIQSIFTRDLASVARLRVAKGDVNDNFQGVLQ
NVRFVFGTTPEDILRNKGCSSSTNVLLTLDNNVVNGSSP
AIRTNYIGHKTKDLQAICGLSCDELSSMVLELKGLRTIV
TTLQDSIRKVTEENRELVSELKRPPLCFHNGVQYKNNEE
WTVDSCTECHCQNSVTICKK

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Binds heparin. May play a role in dentinogenesis and/or maintenance of dentin and dental pulp. Ligand for CD36 mediating antiangiogenic properties. Plays a role in ER stress response, via its interaction with the activating transcription factor 6 alpha (ATF6) which produces adaptive ER stress response factors. 1 Publication

Characterization of the murine thrombospondin gene.Lawler J., Duquette M., Ferro P., Copeland N.G., Gilbert D.J., Jenkins N.A.Genomics 11:587-600(1991) Characterization of mouse thrombospondin 2 sequence and expression during cell growth and development.Laherty C.D., O'Rourke K., Wolf F.W., Katz R., Seldin M.F., Dixit V.M.J. Biol. Chem. 267:3274-3281(1992) Characterization of the mouse thrombospondin gene and evaluation of the role of the first intron in human gene expression.Bornstein P., Alfi D., Devarayalu S., Framson P., Li P.J. Biol. Chem. 265:16691-16698(1990) Expression and initial characterization of recombinant mouse thrombospondin 1 and thrombospondin 3.Chen H., Aeschlimann D., Nowlen J., Mosher D.F.FEBS Lett. 387:36-41(1996) The mouse C2C12 myoblast cell surface N-linked glycoproteome identification, glycosite occupancy, and membrane orientation.Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.Mol. Cell. Proteomics 8:2555-2569(2009) A thrombospondin-dependent pathway for a protective ER stress response.Lynch J.M., Maillet M., Vanhoutte D., Schloemer A., Sargent M.A., Blair N.S., Lynch K.A., Okada T., Aronow B.J., Osinska H., Prywes R., Lorenz J.N., Mori K., Lawler J., Robbins J., Molkentin J.D.Cell 149:1257-1268(2012)

549134

P35441.1

P35441

40.7kD

Bladder Cancer Pathway (83308); Bladder Cancer Pathway (527); ECM-receptor Interaction Pathway (83265); ECM-receptor Interaction Pathway (479); Extracellular Matrix Organization Pathway (1323909); Focal Adhesion Pathway (198353); Focal Adhesion Pathway (83264); Focal Adhesion Pathway (478); Hemostasis Pathway (1323559); Inflammatory Response Pathway (198280)

The protein encoded by this gene is a subunit of a disulfide-linked homotrimeric protein. This protein is an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. This protein can bind to fibrinogen, fibronectin, laminin, type V collagen and integrins alpha-V/beta-1. This protein has been shown to play roles in platelet aggregation, angiogenesis, and tumorigenesis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]

THBS1: Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Binds heparin. May play a role in dentinogenesis and/or maintenance of dentin and dental pulp. Ligand for CD36 mediating antiangiogenic properties. Belongs to the thrombospondin family. Protein type: Motility/polarity/chemotaxis; Inhibitor. Cellular Component: cell surface; cytoplasm; endoplasmic reticulum; external side of plasma membrane; extracellular matrix; extracellular region; extracellular space; fibrinogen complex; sarcoplasmic reticulum; secretory granule. Molecular Function: calcium ion binding; extracellular matrix binding; fibroblast growth factor binding; fibronectin binding; heparin binding; integrin binding; laminin binding; low-density lipoprotein binding; phosphatidylserine binding; protein binding; transforming growth factor beta binding. Biological Process: activation of MAPK activity; behavioral response to pain; blood vessel morphogenesis; cell adhesion; cell cycle arrest; cell migration; engulfment of apoptotic cell; inflammatory response; negative regulation of angiogenesis; negative regulation of antigen processing and presentation of peptide or polysaccharide antigen via MHC class II; negative regulation of apoptosis; negative regulation of blood vessel endothelial cell migration; negative regulation of caspase activity; negative regulation of cell-matrix adhesion; negative regulation of dendritic cell antigen processing and presentation; negative regulation of endothelial cell proliferation; negative regulation of fibrinolysis; negative regulation of fibroblast growth factor receptor signaling pathway; negative regulation of interleukin-12 production; peptide cross-linking; positive regulation of angiogenesis; positive regulation of blood coagulation; positive regulation of blood vessel endothelial cell migration; positive regulation of cell migration; positive regulation of chemotaxis; positive regulation of macrophage activation; positive regulation of phosphorylation; positive regulation of protein kinase B signaling cascade; positive regulation of transforming growth factor beta receptor signaling pathway; positive regulation of translation; positive regulation of tumor necrosis factor biosynthetic process; regulation of cGMP metabolic process; response to calcium ion; response to glucose stimulus; response to magnesium ion; response to mechanical stimulus; response to unfolded protein; sprouting angiogenesis

0.05 mg (Yeast)

190 USD

0.05 mg (E-Coli)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750