protein

Recombinant Human 14 kDa phosphohistidine phosphatase

MBS1265121

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human 14 kDa phosphohistidine phosphatase

14 kDa phosphohistidine phosphatase

Phosphohistidine phosphatase 1; Protein janus-A homolog

14 kDa phosphohistidine phosphatase isoform 2; 14 kDa phosphohistidine phosphatase; 14 kDa phosphohistidine phosphatase; phosphohistidine phosphatase 1; Phosphohistidine phosphatase 1; Protein janus-A homolog

PHPT1

PHPT1; PHPT1; PHP14; CGI-202; HSPC141; HEL-S-132P; PHP14

PHP14_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-125

124

MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAE
SKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGR
ISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYE
VTWANDGY

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Cell Biology

Exhibits phosphohistidine phosphatase activity.

Identification and characterization of a mammalian 14-kDa phosphohistidine phosphatase.Ek P., Pettersson G., Ek B., Gong F., Li J.-P., Zetterqvist O.Eur. J. Biochem. 269:5016-5023(2002) Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M., Zhou J., Xu S.-H., Gu J., Shi J.-X., Jin W.-R., Zhang C.-K., Wu T.-M., Huang G.-Y., Chen Z., Chen M.-D., Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000) Identification of the human crooked neck gene by comparative gene identification.Lai C.-H., Chiu J.-Y., Lin W.-C.Biochim. Biophys. Acta 1517:449-454(2001) Towards a catalog of human genes and proteins sequencing and analysis of 500 novel complete protein coding human cDNAs.Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B., Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.Genome Res. 11:422-435(2001) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)

209529723

NP_001129333.1

NM_001135861.2

Q9NRX4

41.2kD

This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation and inhibition of KCa3.1 channels. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

PHPT1: a phosphohistidine phosphatase. Present preferentially in heart and skeletal muscle. Insensitive to inhibition by okadaic acid and EDTA. Protein type: Motility/polarity/chemotaxis; Cofactor and Vitamin Metabolism - thiamine; Phosphatase; Cofactor and Vitamin Metabolism - riboflavin; Carbohydrate Metabolism - fructose and mannose; EC 3.1.3.-. Chromosomal Location of Human Ortholog: 9q34.3. Cellular Component: cytosol. Molecular Function: calcium channel inhibitor activity; phosphohistidine phosphatase activity; phosphoprotein phosphatase activity. Biological Process: negative regulation of lyase activity; negative regulation of T cell receptor signaling pathway; protein amino acid dephosphorylation

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (E-Coli)

750