protein

Recombinant Human Proto-oncogene c-Rel protein

MBS1265117

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Proto-oncogene c-Rel protein

Proto-oncogene c-Rel

proto-oncogene c-Rel isoform 2; Proto-oncogene c-Rel; proto-oncogene c-Rel; v-rel avian reticuloendotheliosis viral oncogene homolog

REL

REL; REL; C-Rel

REL_HUMAN

E Coli

3-616; Partial.

616

SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHST
DNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLV
GKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAI
ITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPD
EHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGS
VRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADV
HRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESM
DFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRH
VDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGS
IGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPG
PISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSF
STRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIV
GMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGET
DNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGA
NSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPN
SHGFVQDSQYSGIGSMQNEQLSDSFPYEF

Greater than 90% as determined by SDS-PAGE.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Transcription

Proto-oncogene that may play a role in differentiation and lymphopoiesis. NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with mbers of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. The NF-kappa-B heterodimer RELA/p65-c-Rel is a transcriptional activator.

A human rel proto-oncogene cDNA containing an Alu fragment as a potential coding exon.Brownell E., Mittereder N., Rice N.R.Oncogene 4:935-942(1989) NHLBI resequencing and genotyping service (RS&G) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Genetic characterization of human c-rel sequences.Brownell E., O'Brien S.J., Nash W.G., Rice N.R.Mol. Cell. Biol. 5:2826-2831(1985) A novel complex between the p65 subunit of NF-kappa B and c-Rel binds to a DNA element involved in the phorbol ester induction of the human urokinase gene.Hansen S.K., Nerlov C., Zabel U., Verde P., Johnsen M., Baeuerle P.A., Blasi F.EMBO J. 11:205-213(1992) Activation of multiple NF-kappa B/Rel DNA-binding complexes by tumor necrosis factor.Beg A.A., Baldwin A.S. Jr.Oncogene 9:1487-1492(1994) Regulation of intercellular adhesion molecule-1 gene by tumor necrosis factor-alpha is mediated by the nuclear factor-kappaB heterodimers p65/p65 and p65/c-Rel in the absence of p50.Aoudjit F., Brochu N., Belanger B., Stratowa C., Hiscott J., Audette M.Cell Growth Differ. 8:335-342(1997) A new member of the IkappaB protein family, IkappaB epsilon, inhibits RelA (p65) -mediated NF-kappaB transcription.Li Z., Nabel G.J.Mol. Cell. Biol. 17:6184-6190(1997) Tumor necrosis factor-alpha activation of NF-kappa B requires the phosphorylation of Ser-471 in the transactivation domain of c-Rel.Martin A.G., Fresno M.J. Biol. Chem. 275:24383-24391(2000) Leishmania major amastigotes induce p50/c-Rel NF-kappa B transcription factor in human macrophages involvement in cytokine synthesis.Guizani-Tabbane L., Ben-Aissa K., Belghith M., Sassi A., Dellagi K.Infect. Immun. 72:2582-2589(2004) Inhibition of NF-kappaB activity by IkappaBbeta in association with kappaB-Ras.Chen Y., Vallee S., Wu J., Vu D., Sondek J., Ghosh G.Mol. Cell. Biol. 24:3048-3056(2004) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012)

619534182

NP_001278675.1

NM_001291746.1

Q04864

72kD

Activation Of NF-kappaB In B Cells Pathway (1269186); Adaptive Immune System Pathway (1269171); Atypical NF-kappaB Pathway (137946); B Cell Receptor Signaling Pathway (198909); Downstream Signaling Events Of B Cell Receptor (BCR) Pathway (1269185); Immune System Pathway (1269170); Leptin Signaling Pathway (672456); Ras Signaling Pathway (868085); Regulation Of Androgen Receptor Activity Pathway (138027); Signaling By The B Cell Receptor (BCR) Pathway (1269183)

This gene encodes a protein that belongs to the Rel homology domain/immunoglobulin-like fold, plexin, transcription factor (RHD/IPT) family. Members of this family regulate genes involved in apoptosis, inflammation, the immune response, and oncogenic processes. This proto-oncogene plays a role in the survival and proliferation of B lymphocytes. Mutation or amplification of this gene is associated with B-cell lymphomas, including Hodgkin's lymphoma. Single nucleotide polymorphisms in this gene are associated with susceptibility to ulcerative colitis and rheumatoid arthritis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2014]

REL: a proto-oncogenic transcription factor of the nuclear factor-kappaB (NFkB) group. There are five NFkB proteins in mammals (RelA/NFkB-p65, RelB, c-Rel, NF-_B1/NFkB-p105, and NF-_B2/NFkB-p100). They form a variety of homodimers and heterodimers, each of which activates its own characteristic set of genes. May play a role in differentiation and lymphopoiesis. Protein type: Transcription factor; Oncoprotein. Chromosomal Location of Human Ortholog: 2p13-p12. Cellular Component: cytosol; nucleoplasm; nucleus; transcription factor complex. Molecular Function: chromatin binding; protein binding; transcription factor activity. Biological Process: cytokine production; I-kappaB kinase/NF-kappaB cascade; inflammatory response; innate immune response; negative regulation of interferon-beta production; negative regulation of transcription from RNA polymerase II promoter; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of interleukin-12 biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; response to cytokine stimulus; transcription from RNA polymerase II promoter

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180