product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human Antigen KI-67, partial
catalog :
MBS1265096
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1265096
products type :
Recombinant Protein
products full name :
Recombinant human Antigen KI-67, partial
products short name :
Antigen KI-67
other names :
antigen KI-67 isoform 2; Antigen KI-67; antigen KI-67; proliferation-related Ki-67 antigen; antigen identified by monoclonal antibody Ki-67
other gene names :
MKI67; MKI67; KIA; MIB-1
uniprot entry name :
KI67_HUMAN
host :
E Coli
sequence positions :
3120-3256aa; Fragment at the C-terminal.
sequence :
NQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRS HRDSEDI
NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRS
ARQNESSQPKVAEESGGQKSAKVLMQ
purity :
>90%(SDS-PAGE)
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.Notes ? Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
products description :
Thought to be required for maintaining cell proliferation.
ncbi gi num :
225543215
ncbi acc num :
NP_001139438.1
ncbi gb acc num :
NM_001145966.1
uniprot acc num :
P46013
ncbi mol weight :
20kD
ncbi summary :
This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X. [provided by RefSeq, Mar 2009]
uniprot summary :
KI-67: a protein that may be a marker of proliferating cells, involved in chromatin compaction. Its expression is altered in many tumor types including osteosarcomas, histiocytomas, prostate, breast and esophageal cancers. Mutated in colon, cervical and lung cancers. Protein type: Nucleolus; Cell cycle regulation. Chromosomal Location of Human Ortholog: 10q26.2. Cellular Component: membrane; cytoplasm; nucleolus; condensed chromosome; nucleus; chromosome, pericentric region. Molecular Function: protein C-terminus binding; protein binding; ATP binding. Biological Process: meiosis; cell proliferation
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.05 mg (Yeast)
price2 :
260
size3 :
0.2 mg (E-Coli)
price3 :
490
size4 :
0.2 mg (Yeast)
price4 :
600
size5 :
0.5 mg (E-Coli)
price5 :
715
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!